Recombinant African swine fever virus Transmembrane protein C257L (Ken-078)

Shipped with Ice Packs
In Stock

Description

Introduction

African swine fever (ASF) is a highly contagious and deadly disease affecting domestic and wild pigs, leading to significant economic losses worldwide . The African swine fever virus (ASFV) has a complex genome encoding a large number of proteins, many of which have unknown functions. Among these proteins is the transmembrane protein C257L, a putative structural component of the virus . Recent research has focused on understanding the role of C257L in the ASFV life cycle and its potential as a target for vaccine development .

General Information

Recombinant African swine fever virus Transmembrane protein C257L (Ken-078) refers to the C257L protein of ASFV produced using recombinant DNA technology. This allows researchers to study the protein in isolation and investigate its function. The C257L protein is a highly conserved protein across different ASFV genotypes . The protein includes a single transmembrane segment, suggesting it is involved in membrane-associated processes .

Characteristics

CharacteristicDescription
NameRecombinant African swine fever virus Transmembrane protein C257L
Other NamesKen-078, War-076
FunctionUnknown; possibly essential for the ASFV life cycle
Transmembrane DomainsContains at least one transmembrane domain
ConservationHighly conserved among different ASFV genotypes
Palmitoylation SitesC5, C18, C20, and C257

Research Findings

  1. Essential Role in ASFV Life Cycle: Attempts to create a C257L knockout virus were unsuccessful, suggesting that the C257L protein is essential for completing the ASFV life cycle .

  2. Location: C257L is present in the virion, which suggests it is a structural protein .

  3. Mutations and Virulence: Mutations in the C257L protein have been linked to the reversion of attenuated ASFV strains to virulence .

  4. Palmitoylation: C257L is subject to palmitoylation, a post-translational modification involving the addition of palmitic acid, which may affect its function and localization .

Palmitoylation of C257L

Palmitoylation is a lipid modification that can influence protein trafficking, stability, and interactions.

  • C257L has multiple potential palmitoylation sites (C5, C18, C20, and C257) .

  • Palmitoylation typically occurs in transmembrane or membrane-associated proteins .

Recombinant Production

Recombinant C257L protein can be produced in E. coli by fusing the C257L protein with a Histidine tag . The recombinant protein can be used for antibody production and antigenicity analysis .

Potential Applications

  1. Vaccine Development: Understanding the structure and function of C257L may aid in the development of effective ASF vaccines .

  2. Diagnostic Assays: Recombinant C257L can be used as an antigen for detecting ASFV-specific antibodies in diagnostic assays such as ELISA .

  3. Drug Discovery: Targeting C257L could lead to the development of antiviral drugs that disrupt the ASFV life cycle.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Ken-078; Transmembrane protein C257L; pC257L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Target Names
Ken-078
Target Protein Sequence
MYSACDVVRDAMAQSHLCACPNDKLPQCKGVTKAPPECSVFHVAKLQDTKFKWKYTLDPL RAQKLDQINKDIEKDAITLRLIYGIELSPEDLEWWKMQRCLINKNTGAKGGQFANKYLER QDLELLGYSPTPLIGGDLMFTALPDKVLRTIPVAWDRFLNPAIMIFFLIILLCVILGIFY VLVRNTLRRKQKNKLHQMEIKRFIKEKEQDPYIHTSFESWPADPNKEWKDLIPVYEAQGY CMADYRKKLGMPPGPNC
Uniprot No.

Target Background

Protein Families
Asfivirus C257R family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of C257L within the ASFV genome?

The C257L protein is encoded within the African swine fever virus genome, which varies in length from approximately 170 to 193 kbp depending on the isolate. ASFV contains between 150 and 167 open reading frames (ORFs), with approximately half of the encoded proteins having unknown or poorly characterized functions . The C257L gene is one of several transmembrane proteins encoded by ASFV. The virus belongs to the Asfarviridae family and is endemic to sub-Saharan Africa, where it exists in a natural cycle between ticks and wild swine including bushpigs and warthogs . Understanding the genomic context of C257L is crucial for interpreting its evolutionary significance and functional relationships with other viral proteins.

What is the predicted structural organization of the C257L transmembrane protein?

The C257L protein is characterized as a transmembrane protein, suggesting it contains hydrophobic domains that span cellular membranes. Similar to other ASFV transmembrane proteins like pE66L, it likely consists of extramembrane domains, transmembrane (TM) domains, and intramembrane domains . Based on the structural analysis of related ASFV proteins, the transmembrane domains are typically crucial for protein function and cellular localization. For example, the TM domain (amino acids 13-34) of pE66L is essential for its ability to inhibit host gene expression . Structural prediction tools such as GOR4 would likely reveal the secondary structure characteristics, including the percentage of residues forming α-helices, random coils, and extended strands, similar to analyses performed on other ASFV proteins .

How does C257L compare to other known ASFV transmembrane proteins?

When analyzing the functional relationships between different ASFV transmembrane proteins, it's important to consider their diverse roles in viral replication and host interaction. Several ASFV transmembrane proteins, including pE66L, have demonstrated abilities to manipulate host cellular processes. For instance, pE66L significantly inhibits host protein synthesis through its transmembrane domain . The C257L protein should be compared with these proteins in terms of sequence homology, domain organization, and cellular localization to understand its potential functional similarities or unique characteristics. Multiple sequence alignment and phylogenetic analysis would reveal its evolutionary relationship with homologous proteins from different ASFV isolates, potentially providing insights into its conservation and importance for viral fitness.

What role might C257L play in ASFV immune evasion strategies?

ASFV employs multiple strategies to evade host immune responses, many mediated by transmembrane proteins. Several ASFV proteins, including A238L, K145R, and I329L, are known to play important roles in viral pathogenesis by inhibiting host antiviral pathways and innate immunity . Based on functional studies of other ASFV proteins, C257L may potentially interfere with host immune signaling cascades, cytokine production, or antigen presentation. The protein could function similarly to pE66L, which activates the PKR/eIF2α pathway to broadly inhibit host protein synthesis . Researchers should investigate whether C257L interacts with specific host immune factors, and whether its deletion affects viral virulence in experimental models. Examining the protein's expression kinetics during infection and its subcellular localization would provide additional insights into its potential immune evasion functions.

How might C257L interact with host cell membranes and affect cellular compartmentalization?

As a transmembrane protein, C257L likely interacts with host cell membranes, potentially affecting membrane integrity, trafficking, or compartmentalization. Studies of other ASFV transmembrane proteins have shown that they can localize to specific organelles such as the endoplasmic reticulum (ER) . The transmembrane domains of these proteins are often critical for their cellular localization and function. Researchers should employ fluorescence microscopy with tagged C257L constructs to determine its subcellular localization, and conduct co-immunoprecipitation experiments to identify host protein interaction partners. Changes in membrane permeability, organelle morphology, or vesicular trafficking following C257L expression would provide insights into its effects on cellular compartmentalization and potential contribution to viral factory formation.

What is the impact of C257L deletion on ASFV replication and virulence?

Gene deletion studies provide valuable insights into protein function within the viral lifecycle. Research on other ASFV proteins has shown that while some genes like pE66L have minimal effects on virus replication when deleted, they may significantly affect host protein synthesis . In contrast, other viral proteins may be essential for replication or attenuate the virus when removed. To understand C257L's role, researchers should generate C257L deletion mutants using synthetic genomics-based approaches similar to those used for other ASFV genes . The growth kinetics, plaque morphology, and protein expression profiles of these mutants should be compared to wild-type virus in vitro. Furthermore, virulence studies in swine models would reveal whether C257L deletion attenuates the virus, making it a potential target for vaccine development.

How can synthetic genomics approaches be applied to study C257L function?

Synthetic genomics provides powerful tools for manipulating the ASFV genome to study protein function. Recent advances have enabled the engineering of ASFV through CRISPR-Cas9 editing and genome assembly in yeast and E. coli systems . To study C257L, researchers could apply similar approaches to generate modified viral genomes with C257L deletions, mutations, or fluorescent protein tags. The methodology involves several key steps:

  • Fragmenting the viral genome into manageable pieces

  • Modifying the fragment containing C257L using in vitro CRISPR-Cas9 editing

  • Reassembling the full-length genome in yeast or E. coli

  • Transfecting the assembled genome into permissive cells with helper virus

  • Isolating and characterizing the recombinant viruses

This approach allows for precise genetic modifications, although researchers should be aware of potential complications from homologous recombination between the engineered genome and helper virus .

How can immunoinformatics approaches be applied to C257L for vaccine development?

Immunoinformatics offers rapid and cost-effective strategies for ASFV vaccine design. For C257L-based vaccine development, researchers should follow a systematic approach similar to that used for other ASFV proteins :

  • Epitope prediction: Identify potential B-cell and T-cell epitopes within C257L using algorithms that predict antigenicity, surface accessibility, and MHC binding

  • Conservation analysis: Assess epitope conservation across different ASFV isolates

  • Construct design: Develop multi-epitope vaccine constructs incorporating selected C257L epitopes with appropriate linkers and adjuvants

  • Structural validation: Perform secondary and tertiary structure prediction and refinement

  • Immune simulation: Use computational tools like C-ImmSim to predict immune responses

  • Molecular docking: Evaluate interactions between epitopes and immune receptors like SLA-1*04:01 (swine leukocyte antigen)

This approach would generate potential vaccine candidates for experimental validation. The selection of suitable adjuvants, such as the 50S ribosomal protein L7/L12 used in other ASFV vaccine designs, is critical for enhancing immunogenicity .

How can researchers address the challenge of C257L protein insolubility during purification?

Transmembrane proteins like C257L present significant challenges for purification due to their hydrophobic domains. Researchers frequently encounter protein insolubility, aggregation, and loss of native conformation during extraction from membranes. To overcome these challenges, a systematic approach is necessary:

  • Detergent screening: Test a panel of detergents (non-ionic, zwitterionic, and ionic) at various concentrations to identify optimal solubilization conditions

  • Protein engineering: Consider expressing only soluble domains or creating fusion constructs with solubility-enhancing tags

  • Amphipol substitution: Replace detergents with amphipathic polymers for improved stability

  • Nanodiscs or liposomes: Reconstitute the protein into lipid environments that mimic native membranes

The purification protocol should be carefully optimized with gentle extraction conditions, appropriate buffer components, and temperature control throughout the process. Researchers should monitor protein quality using size-exclusion chromatography, dynamic light scattering, and functional assays to ensure the purified protein maintains its native structure and activity.

What strategies can address conflicting data on C257L function across different ASFV isolates?

When confronted with conflicting results about C257L function from studies using different ASFV isolates, researchers should implement a systematic comparative approach:

  • Sequence comparison: Perform detailed sequence alignments of C257L across isolates to identify variations that might explain functional differences

  • Standardized protocols: Develop and apply consistent experimental protocols across isolates to minimize methodology-induced variations

  • Domain swapping: Create chimeric proteins exchanging domains between C257L variants to identify regions responsible for functional differences

  • Host cell factors: Investigate whether differences in host cell backgrounds contribute to varying results

  • Viral genetic context: Examine whether interactions with other viral proteins differ between isolates

This systematic approach allows researchers to determine whether functional differences are genuine isolate-specific adaptations or artifacts of experimental variation. Publishing comprehensive datasets that include negative results and apparent contradictions is essential for advancing understanding of this complex virus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.