Recombinant African swine fever virus Transmembrane protein C257L (Mal-074)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Mal-074; Transmembrane protein C257L; pC257L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Target Names
Mal-074
Target Protein Sequence
MYSVCDVVRDAVAQSHLCACPNDKLPQCKGVTKAPPECSVFHLAKLQDTKFKWKYTLDPL KAQKLDQINKDIEKDAITLKLIYGTELSPEDVEWWKMQRCLINKNTGAKGGQFAHKYLER QDLELLGYSPTSLIGGDLMFTALPDKVLRTIPVVWDRFLNPAMMIFFLIILLCIILGIFY VLVRNTLRRKQKSKQHQMEIKRFIKEKEQDPYIHTSFESWPADPNKEWKELIPVYEAQGY CMADYRKKLGMPPVPNC
Uniprot No.

Target Background

Protein Families
Asfivirus C257R family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is C257L protein and where is it located in the ASFV virion?

C257L is an uncharacterized transmembrane protein found in African swine fever virus with a molecular weight of approximately 30.2 kDa. Proteomic analysis of highly purified extracellular ASFV particles has confirmed its presence in the virion structure . While its precise localization within the virion remains to be determined through immunoelectron microscopy, its transmembrane domain suggests it may be associated with one of the viral membranes. The protein has been detected at relatively low abundance compared to major structural proteins, with a normalized spectral abundance factor (NSAF) of 0.19 in proteomic analyses . Despite its consistent detection in virions, its specific function remains largely unknown.

How does C257L compare to other ASFV transmembrane proteins?

ASFV contains several transmembrane proteins that perform diverse functions in the viral life cycle. Unlike well-characterized transmembrane proteins such as pEP84R (which plays a crucial role in core assembly by targeting core shell polyproteins to the inner viral envelope) or pE66L (which inhibits host translation) , the specific function of C257L remains undefined. Comparative analysis shows that while pEP84R interacts with viral polyproteins pp220 and pp62 to facilitate core assembly , and pE66L contains a transmembrane domain (amino acids 13-34) that inhibits host gene expression through the PKR/eIF2α pathway , similar functional analyses for C257L are lacking. This knowledge gap represents an important area for future research, particularly given recent findings suggesting C257L mutations may influence viral virulence .

What experimental approaches are recommended for initial characterization of C257L?

For researchers beginning to study C257L, a systematic approach should include:

  • Expression studies using epitope-tagged versions in mammalian or insect cell systems

  • Subcellular localization analysis using confocal microscopy of infected cells

  • Generation of specific antibodies for immunodetection and immunoprecipitation

  • Bioinformatic analysis of sequence conservation across ASFV isolates

  • Preliminary interaction studies to identify binding partners

Each approach provides complementary information about this poorly characterized protein. Researchers should note that transmembrane proteins often present technical challenges in expression and purification, requiring specialized detergents and buffer conditions to maintain native conformation and function.

What are the optimal approaches for generating recombinant ASFV with C257L modifications?

Creating recombinant ASFV with C257L modifications requires careful design and implementation of homologous recombination techniques. Based on established protocols, researchers should:

  • Design a transfer plasmid containing:

    • Modified C257L gene or deletion construct

    • A fluorescent reporter gene (e.g., mNeonGreen) under an appropriate ASFV promoter

    • Homologous flanking regions (typically 800-1000bp) for targeting

  • Perform infection/transfection in susceptible cells:

    • Infect WSL-R cells with parent ASFV strain (MOI of 2)

    • Centrifuge at 600g for 1 hour to enhance infection

    • After 3 hours incubation, transfect with the transfer plasmid

    • Centrifuge again at 600g for 1 hour

    • Incubate for 48 hours at 37°C with 5% CO₂

  • Isolate recombinant viruses:

    • Use flow cytometry to sort reporter-positive cells (typically 0.1-3.0% of the population)

    • Plate sorted cells into individual wells containing purified porcine macrophages

    • Perform multiple rounds of sorting to obtain pure recombinant virus

This approach typically yields low recombination frequencies, necessitating careful screening and purification steps to isolate the desired recombinant virus.

What controls should be included when analyzing C257L mutant viruses?

When studying C257L mutants, comprehensive controls must include:

  • Primary controls:

    • Wild-type parental virus

    • Revertant virus (mutant with restored wild-type sequence)

    • Control recombinant virus with mutations in non-functional regions

  • Experimental validations:

    • Western blot confirmation of protein expression changes

    • Next-generation sequencing to verify the intended genetic modification

    • Growth curves in multiple cell types (macrophages and permissive cell lines)

    • Multi-step growth kinetics at different MOIs

  • Additional considerations:

    • Passaging experiments to assess genetic stability

    • In vivo experiments to evaluate virulence changes

    • Complementation studies to confirm phenotype specificity

The recent discovery that C257L mutations may influence virulence highlights the importance of these controls, particularly when developing attenuated vaccine candidates .

How can researchers overcome challenges in generating C257L knockout viruses?

Creating C257L knockout viruses presents several technical challenges:

  • Potential essentiality:

    • If C257L is essential for virus replication, direct knockouts may be non-viable

    • Solution: Use inducible expression systems similar to those used for EP84R

    • Establish cell lines expressing C257L that can complement the deletion

  • Low recombination efficiency:

    • Homologous recombination may occur at frequencies below 0.1%

    • Solution: Optimize infection/transfection procedures with multiple centrifugation steps

    • Include positive selection markers in the transfer plasmid

  • Purification difficulties:

    • Multiple rounds of plaque purification may be needed

    • Solution: Use FACS-based single-cell sorting of fluorescent reporter-positive cells

    • Verify purity through PCR screening of multiple isolated viral clones

  • Phenotype analysis:

    • Knockouts may produce subtle phenotypes difficult to detect

    • Solution: Apply multiple complementary assays (growth kinetics, electron microscopy, etc.)

    • Consider competition assays between wild-type and knockout viruses

These approaches have proven successful for characterizing other ASFV genes and can be adapted for C257L studies.

What methods are most effective for studying the transmembrane domain of C257L?

The transmembrane domain of C257L requires specialized approaches:

  • Computational methods:

    • Transmembrane helix prediction algorithms (TMHMM, Phobius)

    • Molecular dynamics simulations in membrane environments

    • Ab initio modeling of transmembrane segments

  • Biochemical approaches:

    • Systematic mutagenesis of predicted transmembrane residues

    • Protease protection assays to determine membrane topology

    • Cysteine accessibility methods to map membrane-embedded regions

  • Structural biology techniques:

    • NMR spectroscopy of isotopically labeled domains in membrane mimetics

    • Electron crystallography of 2D crystals

    • Cryo-EM of membrane protein complexes

  • Functional analysis:

    • Domain swapping with other viral transmembrane proteins

    • Construction of chimeric transmembrane proteins to identify functional regions

    • Isolation of the transmembrane domain fused to reporter proteins to determine its intrinsic properties

These complementary approaches can provide insights into how the transmembrane domain contributes to C257L function and potentially influences viral fitness and virulence.

How can researchers identify host and viral interaction partners of C257L?

To identify C257L interaction partners, researchers should employ multiple complementary techniques:

  • Affinity-based methods:

    • Co-immunoprecipitation with epitope-tagged C257L

    • Pull-down assays with recombinant C257L fragments

    • Cross-linking followed by mass spectrometry (XL-MS)

  • Proximity labeling approaches:

    • BioID or TurboID fusion to C257L expressed in infected cells

    • APEX2-mediated proximity labeling

    • Identification of labeled proteins by mass spectrometry

  • Genetic screening approaches:

    • Yeast two-hybrid using the soluble domains of C257L

    • Mammalian two-hybrid assays

    • CRISPR screens to identify host factors affecting C257L function

  • Computational predictions:

    • Structural modeling to identify potential interaction interfaces

    • Sequence-based prediction of binding motifs

    • Co-evolution analysis to predict functional interactions

These methods should be applied with appropriate controls, including using mutant versions of C257L to validate specific interactions. Similar approaches have successfully identified interaction partners for other ASFV proteins, such as the binding between pEP84R and the N-terminal region of polyprotein pp220 .

What is the current evidence linking C257L mutations to changes in ASFV virulence?

Recent research has revealed important connections between C257L mutations and ASFV virulence:

  • Key findings:

    • Whole genome sequencing identified C257L mutations as potential drivers of increased replication fitness and virulence in the ASFV-G-ΔI177L vaccine strain

    • During passage experiments, C257L mutations emerged concurrently with reversion to virulence

    • The correlation between C257L mutations and increased viremia levels suggests functional significance

  • Comparative context:

    • Similar virulence-modulating effects have been observed with other ASFV genes

    • The transmembrane protein pEP84R influences viral assembly and may indirectly affect virulence

    • The I177L gene (which was deleted in the vaccine strain showing C257L mutations) is also characterized as a transmembrane protein with unclear function

  • Research limitations:

    • Direct causality between specific C257L mutations and virulence has not been established

    • The molecular mechanisms by which C257L mutations might enhance virulence remain unknown

    • Potential epistatic interactions with other viral genes complicate interpretation

This evidence suggests C257L may play an important role in viral fitness and virulence, warranting further investigation into its function and potential as a target for virus attenuation.

How does C257L potentially contribute to ASFV replication and assembly?

While the specific function of C257L remains unknown, its characteristics suggest several possible roles in viral replication:

  • Potential structural roles:

    • As a virion component, C257L may contribute to particle architecture

    • Its transmembrane domain could anchor it in the viral envelope

    • It might function similarly to pEP84R in targeting viral components to assembly sites

  • Possible regulatory functions:

    • C257L could modulate viral gene expression or genome replication

    • It might interact with host factors to create favorable conditions for viral replication

    • Similar to pE66L, it could potentially influence host cell processes

  • Assembly contributions:

    • C257L may participate in the complex ASFV assembly process

    • It could help coordinate the formation of multilayered virion structure

    • Its presence in the virion suggests incorporation during assembly rather than after maturation

  • Host interactions:

    • The protein might engage with host membranes or proteins during entry or exit

    • It could potentially contribute to evasion of host defenses

    • Mutations might alter these interactions, explaining virulence changes

Further research using the methodologies described throughout this document is needed to clarify these potential functions.

How can C257L research contribute to ASFV vaccine development strategies?

C257L research has significant implications for ASFV vaccine development:

  • Attenuated vaccine approaches:

    • Understanding how C257L mutations affect virulence could guide rational attenuation strategies

    • The discovery that C257L mutations emerged during passaging of the ASFV-G-ΔI177L vaccine candidate highlights the importance of monitoring this gene in attenuated strains

    • Targeted mutations in C257L could potentially create stable attenuated phenotypes

  • Subunit vaccine considerations:

    • If C257L contains protective epitopes, it could be included in subunit vaccine formulations

    • Structural studies would help identify surface-exposed regions suitable for antibody targeting

    • As a virion component, antibodies against C257L might contribute to neutralization

  • Safety assessment:

    • Monitoring C257L sequence stability in attenuated vaccine candidates is critical

    • Mutations should be screened for potential contribution to reversion to virulence

    • The role of C257L in the reversion to virulence observed with ASFV-G-ΔI177L underscores this need

  • Genetic stability considerations:

    • The emergence of C257L mutations during passaging suggests this region may be under selection pressure

    • Vaccine candidates should be extensively tested for genetic stability at this locus

    • Combined modifications of C257L and other virulence factors might produce more stable attenuation

These research directions highlight the potential value of C257L studies for improving ASFV vaccine safety and efficacy.

What novel methodologies could advance our understanding of C257L function?

Cutting-edge approaches that could illuminate C257L function include:

  • Advanced imaging techniques:

    • Super-resolution microscopy to track C257L localization during infection

    • Correlative light and electron microscopy (CLEM) to connect fluorescence data with ultrastructural context

    • Live-cell imaging with labeled C257L to monitor dynamics during viral assembly

  • Systems biology approaches:

    • Proteomics analysis of differential protein expression in cells infected with wild-type versus C257L mutant viruses

    • Transcriptomics to identify host pathways affected by C257L

    • Metabolomics to detect changes in cellular metabolism potentially mediated by C257L

  • Structural biology innovations:

    • Cryo-electron tomography of virus particles to localize C257L in intact virions

    • Integrative structural modeling combining multiple experimental data sources

    • AlphaFold2 or RoseTTAFold prediction validated by experimental constraints

  • Genetic approaches:

    • CRISPR-Cas9 screening to identify host factors interacting with C257L

    • Transposon mutagenesis of the ASFV genome to find genetic interactions with C257L

    • Deep mutational scanning to comprehensively map functional domains

These innovative approaches could provide unprecedented insights into C257L function and its contribution to ASFV biology.

What are the major technical challenges in studying C257L function?

Researchers face several significant challenges when investigating C257L:

  • Expression and purification difficulties:

    • Transmembrane proteins like C257L are notoriously difficult to express and purify

    • Maintaining proper folding and avoiding aggregation requires specialized approaches

    • Low natural abundance in virions complicates isolation from viral particles

  • Functional assay limitations:

    • Lack of known function makes designing relevant assays challenging

    • Subtle phenotypes may be difficult to detect in standard virology assays

    • Potential redundancy with other viral proteins could mask knockout effects

  • Structural analysis barriers:

    • Membrane proteins present unique challenges for structural determination

    • Crystallization is complicated by hydrophobic transmembrane domains

    • Sample preparation for cryo-EM or NMR requires specialized membrane mimetics

  • Biological containment requirements:

    • ASFV is typically handled in biosafety level 3 facilities

    • This restricts access to certain specialized equipment and techniques

    • Recombinant protein studies outside live virus context may not fully recapitulate function

Addressing these challenges requires interdisciplinary approaches and specialized expertise in membrane protein biochemistry, structural biology, and ASFV biology.

What are the most promising directions for future C257L research?

Based on current knowledge, several research directions appear particularly promising:

  • Structure-function studies:

    • Determine the three-dimensional structure of C257L and its membrane topology

    • Map functional domains through systematic mutagenesis

    • Identify critical residues involved in protein-protein interactions

  • Role in virulence:

    • Generate recombinant viruses with specific C257L mutations identified in virulent revertants

    • Evaluate their phenotypes in vitro and in vivo

    • Determine the molecular basis for virulence modulation

  • Interactions with host factors:

    • Identify host proteins that interact with C257L during infection

    • Determine if C257L interferes with host antiviral responses

    • Investigate potential species-specific interactions that might influence host range

  • Therapeutic targeting:

    • Assess C257L as a potential target for antiviral development

    • Develop antibodies or small molecules that interfere with C257L function

    • Evaluate C257L epitopes for inclusion in subunit vaccine designs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.