Recombinant African swine fever virus Transmembrane protein C257L (Pret-078)

What is the structural characterization of Transmembrane protein C257L?

Transmembrane protein C257L (pC257L) is a full-length protein comprising 257 amino acids encoded by the Pret-078 gene of African swine fever virus. The complete amino acid sequence is: MYSVCDVVRDAVAQSHLCACPNDKLPQCKGVTKAPPECSVFHVAKLQDTKFKWKYTLDPLKAQKLNQINKDIEKDAITLKLLYGIELSPEDLEWWKMQRCLINKKTGAKGGQFANKYLERQDLELLGYSPTPIIGGDFMFTALPDKVLRTIPIAWDRFLNPAMMIFFLIILLCVILGIFYVLVRNTLRRKQKIKQHQMEIKRFIKEKEQDPYIHTSFESWPADPNKEWKELIPVYEAQGYCMADYRKKLGMPPGPNC .

Structural analysis methodologies should include:

• Secondary structure prediction using tools like GOR4, which has been effectively used for ASFV proteins, predicting the proportion of α-helices, random coils, and extended strands

• Tertiary structure modeling with platforms like ColabFold followed by refinement using GalaxyRefine, similar to approaches used for other ASFV proteins

• Membrane topology analysis to confirm transmembrane regions, particularly important as the name suggests membrane-spanning domains

For experimental validation of structural predictions, researchers should implement circular dichroism spectroscopy and nuclear magnetic resonance (NMR) techniques optimized for membrane proteins.

How is Recombinant African swine fever virus Transmembrane protein C257L (Pret-078) produced?

Production of recombinant ASFV proteins typically involves these methodological steps:

• Gene synthesis and vector design: The C257L coding sequence can be synthesized based on the published sequence (UniProt: P0CAB9) and cloned into an appropriate expression vector .

• Expression system selection: While bacterial expression systems (E. coli) offer simplicity and high yields, eukaryotic systems such as insect cells may provide better folding for transmembrane proteins. For C257L, considering its transmembrane nature, baculovirus expression systems may yield more properly folded protein.

• Purification strategy:

  • Initial capture using affinity chromatography (typically His-tag based)

  • Intermediate purification using ion exchange chromatography

  • Polishing step using size exclusion chromatography

  • For membrane proteins like C257L, detergent solubilization is critical during purification

• Quality control: Verify protein identity through mass spectrometry, purity through SDS-PAGE, and structural integrity through circular dichroism.

A common challenge with transmembrane proteins is obtaining sufficient yields of properly folded protein. Researchers may need to optimize solubilization conditions using various detergents (DDM, LMNG, etc.) or consider producing only the soluble domains if the full-length protein proves difficult to express.

What are the optimal storage and handling conditions for Transmembrane protein C257L?

Based on established protocols for similar recombinant viral proteins:

• Storage buffer: Tris-based buffer with 50% glycerol, specifically optimized for Transmembrane protein C257L stability .

• Storage temperature: Store at -20°C for routine use. For extended storage periods, conservation at -80°C is recommended to maintain protein integrity .

• Handling recommendations:

  • Avoid repeated freeze-thaw cycles as they can compromise protein structure and activity

  • Prepare working aliquots to be stored at 4°C for up to one week

  • When thawing, use rapid thawing techniques (room temperature water bath) followed by immediate transfer to ice

• Quality control during storage:

  • Implement periodic analytical SEC to monitor aggregation state

  • Use activity assays (if applicable) to confirm retention of function after storage

These conditions have been specifically optimized for recombinant C257L protein to maintain structural integrity and functional properties.

What is the functional role of Transmembrane protein C257L in ASFV biology?

While the specific functions of C257L are still being elucidated, methodological approaches to investigate its role include:

• Comparative analysis: Examine sequence homology with other viral transmembrane proteins of known function. The conserved domains may suggest functional roles.

• Protein-protein interaction studies:

  • Implement co-immunoprecipitation with host cell proteins

  • Use proximity labeling techniques (BioID, APEX) to identify interaction partners

  • Perform yeast two-hybrid screens against host protein libraries

• Gene deletion studies: Generate recombinant ASFV lacking C257L using homologous recombination and FACS-based purification techniques as demonstrated with other ASFV genes . Phenotypic characterization of these deletion mutants can reveal the protein's role in viral replication, assembly, or host interaction.

• Localization studies: Employ immunofluorescence microscopy with fluorescently tagged C257L to determine subcellular localization during infection, providing clues to function.

By integrating these approaches, researchers can build a comprehensive understanding of C257L's role in the viral life cycle and host interaction.

What techniques are most effective for studying interactions between Transmembrane protein C257L and host cell proteins?

Advanced methodologies for investigating C257L-host interactions include:

• Crosslinking Mass Spectrometry (XL-MS):

  • In vivo crosslinking during infection followed by affinity purification of C257L

  • MS/MS analysis to identify crosslinked peptides from host proteins

  • Structural modeling of interaction interfaces based on crosslink constraints

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Map regions of C257L that change solvent accessibility upon host protein binding

  • Identify conformational changes induced by specific interaction partners

  • Protocol must be optimized for membrane proteins with appropriate detergents

• Single-molecule techniques:

  • Förster Resonance Energy Transfer (FRET) to monitor real-time interactions

  • Total Internal Reflection Fluorescence (TIRF) microscopy to observe membrane dynamics

  • Implementation requires fluorescent labeling strategies optimized for live-cell imaging

• Cryo-Electron Microscopy:

  • Visualize C257L in complex with putative host partners

  • Determine structural changes during different stages of viral infection

  • May require nanodiscs or amphipols to stabilize the transmembrane domains

The proteomic approaches used to characterize ASFV particle composition can be adapted to specifically study C257L interactome by using proximity-dependent biotinylation followed by quantitative proteomics.

How can Transmembrane protein C257L be utilized in developing diagnostic tools for ASFV?

Methodological framework for developing C257L-based diagnostics:

• Epitope mapping:

  • Synthesize overlapping peptide arrays covering the C257L sequence

  • Screen against sera from ASFV-infected animals to identify immunodominant regions

  • Confirm accessibility of epitopes within the native protein structure

• ELISA development:

  • Optimize coating conditions for recombinant C257L on high-binding plates

  • Determine appropriate blocking agents to minimize background

  • Establish calibration curves using known positive and negative samples

  • Validate sensitivity and specificity against diverse ASFV isolates

• Lateral flow assay design:

  • Conjugate purified C257L or derived peptides to colloidal gold nanoparticles

  • Optimize test line antibody selection for maximum specificity

  • Engineer sample pad composition to minimize matrix effects from field samples

• Multiplexed detection platforms:

  • Incorporate C257L alongside other ASFV antigens (p72, p30) in protein microarrays

  • Develop multiplex PCR assays targeting C257L gene and other ASFV genomic regions

  • Validate concordance between protein and nucleic acid detection methods

These approaches leverage the specificity of C257L while addressing the challenges of detecting ASFV in diverse sample types.

What approaches can be used to investigate the immunogenic properties of Transmembrane protein C257L?

Comprehensive immunogenicity assessment methodologies include:

• In silico epitope prediction:

  • Implement immunoinformatics tools to identify potential B-cell and T-cell epitopes

  • Use algorithms that incorporate MHC binding prediction, antigenicity, and surface accessibility

  • Similar approaches have been successful for designing multi-epitope ASFV vaccines

• B-cell response characterization:

  • ELISA-based titration of antibody responses in immunized or infected animals

  • Epitope mapping using peptide arrays or phage display libraries

  • Neutralization assays to assess functional significance of anti-C257L antibodies

• T-cell response analysis:

  • ELISpot assays to enumerate C257L-specific T cells

  • Intracellular cytokine staining to characterize T-cell polarization

  • TCR repertoire analysis to assess clonal expansion after immunization

• Vaccine platform evaluation:

  • Compare different delivery systems (protein subunit, viral vector, DNA vaccine)

  • Assess adjuvant formulations for enhancing C257L immunogenicity

  • Challenge studies to correlate immune responses with protection

The immunoinformatics-guided approach described for ASFV vaccine design provides a valuable framework that can be adapted specifically for C257L-focused immunological studies.

How can genetic manipulation techniques be applied to modify Transmembrane protein C257L for functional studies?

Advanced genetic manipulation strategies include:

• Site-directed mutagenesis:

  • Target conserved motifs or predicted functional domains

  • Create alanine scanning libraries to systematically map functional residues

  • Generate phosphomimetic mutations to study regulation by phosphorylation

• Domain swapping:

  • Replace transmembrane domains with those from related viral proteins

  • Create chimeric constructs to isolate functional domains

  • Engineer reporter fusions that maintain native topology

• CRISPR-Cas9 genome editing of the viral genome:

  • Generate precise mutations in the C257L gene in the context of infectious virus

  • Create conditional expression systems for temporal control of C257L function

  • Introduce epitope tags for improved detection and purification

• Recombination-based viral engineering:

  • Apply the homologous recombination and FACS-based purification methods described for other ASFV genes

  • Use fluorescent reporters to track expression and localization

  • Combine with Cre/loxP systems for sequential genetic modifications

This methodological toolkit allows researchers to precisely dissect C257L function through targeted modifications while monitoring phenotypic consequences.

What are the key considerations for designing experiments with Recombinant Transmembrane protein C257L?

Critical experimental design parameters include:

• Protein quality assessment:

  • Implement rigorous quality control before experiments: purity (>95% by SDS-PAGE), identity (mass spectrometry confirmation), and proper folding (circular dichroism)

  • Verify lot-to-lot consistency using standardized analytical methods

  • Consider the impact of detergents or stabilizing agents on experimental readouts

• Controls and validation:

  • Include denatured protein controls to distinguish structure-dependent effects

  • Use proteins from related viruses as specificity controls

  • Implement both positive and negative controls appropriate for each assay system

• Physiological relevance:

  • Select cell types that reflect natural ASFV targets (e.g., porcine macrophages)

  • Consider using wild boar cell lines (e.g., WSL-R) which support ASFV replication

  • Design experiments at protein concentrations reflecting physiological levels during infection

• Data analysis and reporting:

  • Apply appropriate statistical methods based on experimental design

  • Report all experimental conditions in detail to ensure reproducibility

  • Include raw data and detailed methodologies in publications

These considerations ensure robust, reproducible results when working with this complex transmembrane viral protein.

How can expression systems be optimized for higher yields of functional Transmembrane protein C257L?

Methodological optimization strategies include:

• Expression vector engineering:

  • Evaluate different promoter strengths for optimal expression kinetics

  • Incorporate fusion tags that enhance solubility (SUMO, MBP, TrxA)

  • Consider codon optimization for the expression host

• Host cell selection and modification:

  • Compare prokaryotic (E. coli) vs. eukaryotic (insect, mammalian) expression systems

  • For E. coli, evaluate specialized strains with enhanced membrane protein expression capability (C41(DE3), C43(DE3))

  • Consider chaperone co-expression to improve folding efficiency

• Culture condition optimization:

  • Implement Design of Experiments (DoE) approach to systematically evaluate temperature, inducer concentration, and induction timing

  • For transmembrane proteins, evaluate reduced temperature expression (16-20°C)

  • Test auto-induction media formulations for gradually induced expression

• Extraction and purification refinement:

  • Screen detergent panels to identify optimal solubilization conditions

  • Evaluate nanodiscs or amphipols for maintaining native-like membrane environment

  • Optimize buffer compositions to enhance stability during purification

These methodological approaches address the specific challenges of producing functional transmembrane viral proteins like C257L.

What are the best practices for validating the purity and functionality of recombinant Transmembrane protein C257L preparations?

Comprehensive validation methodology includes:

• Purity assessment:

  • Multi-detection size exclusion chromatography (SEC-MALS-RI) to assess homogeneity and molecular weight

  • SDS-PAGE with both Coomassie and silver staining to detect minor contaminants

  • Western blotting using specific antibodies to confirm identity

• Structural integrity validation:

  • Circular dichroism spectroscopy to confirm secondary structure content

  • Intrinsic fluorescence spectroscopy to assess tertiary structure

  • Limited proteolysis to verify proper folding (properly folded proteins show characteristic proteolytic patterns)

• Functional assays:

  • Lipid binding assays to confirm membrane interaction properties

  • Protein-protein interaction assays with known viral or cellular partners

  • If applicable, enzymatic activity measurements specific to the protein's function

• Stability assessment:

  • Thermal shift assays to determine melting temperature

  • Accelerated stability studies under various storage conditions

  • Activity retention measurements over time

These validation approaches ensure that experimental results obtained with recombinant C257L are attributable to the properly folded, functional protein rather than artifacts of preparation.

How is Transmembrane protein C257L being utilized in vaccine development research?

Methodological approaches for C257L-based vaccine development include:

• Epitope identification and optimization:

  • Apply immunoinformatics tools to identify immunodominant epitopes within C257L

  • Optimize epitope selection based on conservation across ASFV isolates

  • Engineer multi-epitope constructs that combine C257L epitopes with those from other ASFV proteins

• Delivery platform evaluation:

  • Test recombinant protein formulations with various adjuvants

  • Evaluate viral vector systems (adenovirus, MVA) expressing C257L

  • Assess DNA vaccine constructs encoding optimized C257L sequences

• Immune response characterization:

  • Quantify antibody responses using standardized ELISA protocols

  • Evaluate T-cell responses through ELISpot and flow cytometry

  • Assess duration of immunity through longitudinal sampling

• Challenge studies and correlates of protection:

  • Conduct controlled challenge experiments in swine models

  • Identify immune correlates of protection

  • Compare C257L-based vaccines with other ASFV antigen combinations

The immunoinformatics approach used for designing ASFV multi-epitope vaccines provides a framework that can be adapted specifically for C257L-focused vaccine development.

What is the potential of Transmembrane protein C257L as a target for antiviral therapeutics?

Methodological framework for therapeutic development includes:

• Target validation:

  • Generate C257L deletion mutants using recombination techniques to confirm essentiality

  • Identify critical functional domains through mutagenesis

  • Establish cell-based assays that specifically measure C257L function

• Small molecule inhibitor discovery:

  • Develop high-throughput screening assays targeting C257L interactions or functions

  • Implement fragment-based drug discovery approaches

  • Conduct in silico screening against structural models of C257L

• Peptide inhibitor design:

  • Identify protein-protein interaction interfaces involving C257L

  • Design peptide mimetics that competitively inhibit these interactions

  • Optimize cell penetration and stability properties

• Validation methodology:

  • Confirm direct binding to C257L using biophysical techniques (SPR, ITC)

  • Evaluate specificity against related viral proteins

  • Determine antiviral efficacy in cell culture systems

  • Assess cytotoxicity and selectivity indices

These approaches leverage the unique properties of C257L to develop targeted antiviral strategies against ASFV.

How might structural modifications of Transmembrane protein C257L affect virus-host interactions?

Methodological approaches to investigate structure-function relationships include:

• Systematic mutagenesis:

  • Generate alanine scanning libraries across the C257L sequence

  • Create targeted mutations in predicted functional domains

  • Evaluate truncation mutants to identify minimal functional units

• Interaction mapping:

  • Use the mutant library to map critical residues for specific host interactions

  • Implement FRET-based assays to quantify interaction affinities

  • Develop split-reporter systems to monitor interactions in living cells

• Functional consequences assessment:

  • Measure viral fitness parameters with each C257L variant

  • Quantify alterations in host response pathways

  • Track changes in viral tropism or pathogenesis

• Structural biology integration:

  • Solve structures of wild-type and modified C257L in complex with host factors

  • Correlate structural changes with functional outcomes

  • Use molecular dynamics simulations to model conformational effects of modifications

This integrated approach connects structural modifications to functional consequences, providing mechanistic insights into C257L's role in ASFV biology.

What are common issues encountered in Transmembrane protein C257L expression studies and how can they be addressed?

Methodological solutions to expression challenges include:

• Low expression yields:

  • Systematically test induction conditions (temperature, inducer concentration, duration)

  • Evaluate different fusion tags to enhance expression and solubility

  • Consider cell-free expression systems optimized for membrane proteins

• Inclusion body formation:

  • Implement slower induction protocols (reduced temperature, lower inducer concentration)

  • Co-express molecular chaperones to assist folding

  • Develop efficient refolding protocols if recovery from inclusion bodies is necessary

• Protein degradation during expression:

  • Add protease inhibitors to culture media and all buffers

  • Test protease-deficient expression strains

  • Optimize harvest timing to capture maximum intact protein

• Poor extraction efficiency:

  • Screen detergent panels systematically (ranging from harsh to mild)

  • Evaluate detergent-free extraction methods (SMALPs, nanodiscs)

  • Optimize buffer conditions (pH, ionic strength, stabilizing additives)

These troubleshooting approaches address the specific challenges associated with expressing transmembrane viral proteins like C257L.

How can researchers overcome challenges in detecting protein-protein interactions involving Transmembrane protein C257L?

Advanced methodological solutions include:

• Membrane environment optimization:

  • Test various detergent systems that maintain native-like membrane environments

  • Consider nanodiscs or liposome reconstitution to provide physiological lipid contexts

  • Implement membrane-mimetic systems compatible with your detection method

• Sensitivity enhancement:

  • Apply proximity labeling techniques (BioID, APEX) to capture transient interactions

  • Implement bimolecular fluorescence complementation (BiFC) for in vivo visualization

  • Use split-luciferase assays for quantitative interaction measurement

• Background reduction:

  • Develop stringent washing protocols for pull-down experiments

  • Implement SILAC or TMT labeling for quantitative discrimination of specific interactions

  • Use appropriate negative controls (mutated binding sites, unrelated transmembrane proteins)

• Confirmation strategies:

  • Validate interactions through multiple orthogonal techniques

  • Map interaction domains through mutagenesis studies

  • Correlate interaction data with functional outcomes in infection models

These approaches overcome the specific challenges of studying membrane protein interactions in complex biological systems.

What strategies can mitigate issues with protein stability and aggregation during experimental procedures?

Comprehensive stability optimization methodology includes:

• Buffer optimization:

  • Conduct systematic pH screening (typically pH 6.5-8.0 for most viral proteins)

  • Test various ionic strengths (50-500 mM) and ion types (Na+, K+, etc.)

  • Evaluate stabilizing additives (glycerol, arginine, trehalose)

• Detergent selection and management:

  • Maintain detergent concentrations above critical micelle concentration (CMC)

  • Consider detergent exchange to more stable systems for long-term storage

  • Test mixed detergent systems that may provide superior stability

• Sample handling practices:

  • Minimize freeze-thaw cycles by preparing single-use aliquots

  • Implement gentle mixing techniques (avoid vortexing)

  • Centrifuge samples before use to remove any aggregates

• Analytical quality control:

  • Implement dynamic light scattering to monitor aggregation state

  • Use analytical SEC to assess oligomeric distribution

  • Apply thermal shift assays to identify stabilizing conditions