Recombinant African swine fever virus Transmembrane protein C257L (War-076)

Shipped with Ice Packs
In Stock

Description

Protein Palmitoylation and ASFV Replication

Palmitoylation, the addition of palmitic acid to a protein, is a crucial post-translational modification that affects membrane association, protein trafficking, and protein stability . Studies suggest palmitoylation plays a significant role in ASFV replication .

Key findings regarding palmitoylation and ASFV:

  • The ASFV pCP123L is palmitoylated at residue C18 .

  • Palmitoylation of ASFV pCP123L determines its membrane association and subcellular localization .

  • The cysteine residue of pCP123L, when engaged in palmitoylation, significantly impacts the release of infectious ASFV .

  • Depalmitoylation inhibits ASFV replication and impairs the release of wild-type ASFV .

C257L and Other ASFV Proteins

ASFV encodes a variety of proteins that influence its virulence and interaction with the host immune system. For example, the H240R protein, a capsid protein of ASFV, inhibits type I interferon (IFN) production, which is a crucial component of the host's antiviral response . Another ASFV protein, I267L, is associated with hemorrhage, a common symptom of ASF . Deletion of I267L may attenuate the virulence of ASFV . The I7L protein of African swine fever virus is involved in viral pathogenicity and antagonizes the IFN-γ-triggered JAK-STAT signaling pathway .

Relevant ASFV proteins:

ProteinFunction
H240RInhibits type I interferon (IFN) production by targeting STING and inhibiting its oligomerization and translocation from the endoplasmic reticulum to the Golgi apparatus .
I267LModulates the hemorrhages of ASF by suppressing F3 expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
War-076; Transmembrane protein C257L; pC257L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Target Names
War-076
Target Protein Sequence
MYSVCDVVRDAVAQSHLCACPNDKLPQCKGVTKAPPECSVFHVAKLQDTKFKWKYTLDPL KAQKLSQINKDIEKDAITLKLLYGIELSPEDLEWWKMQRCLINKKTGAKGGQFANKYLER QDLELLGYSPTPIIGGDFMFTALPDKVLRTIPIAWDRFLNPAMMIFFLIILLCVILGIFY VLVRNTLRRKQKIKQHQMEIKRFIKEKEQDPYIHTSFESWPADPNKEWKELIPVYEAQGY CMADYRKKLGMPPGPNC
Uniprot No.

Target Background

Protein Families
Asfivirus C257R family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methodologies are most effective for studying War-076 interactions with host cellular factors?

    Elucidating War-076 interactions with host factors requires a multi-faceted approach:

    • Affinity Purification-Mass Spectrometry (AP-MS): Express tagged War-076 in relevant host cells, perform pulldowns, and identify binding partners via LC-MS/MS. This approach has successfully identified interaction networks for other ASFV proteins.

    • Proximity Labeling: Methods such as BioID or APEX2 fusion proteins can identify proximal proteins in living cells, providing spatial context to interactions.

    • Split Reporter Assays: Techniques like yeast two-hybrid or mammalian protein-fragment complementation assays can validate specific protein-protein interactions.

    • Confocal Microscopy: Co-localization studies using fluorescently-tagged War-076 and cellular markers to determine subcellular localization and trafficking.

    • Surface Plasmon Resonance/Bio-Layer Interferometry: For quantitative measurement of binding kinetics between purified War-076 and candidate host factors.

    When designing these experiments, it's critical to consider which expression system-derived War-076 is most appropriate, as post-translational modifications may significantly impact interactions with host factors .

  • How can War-076 be integrated into ASFV vaccine development strategies?

    Integration of War-076 into vaccine development requires strategic approaches that leverage recent technological advances:

    • Reverse Genetics Systems: The newly developed synthetic genomics-based reverse-genetics system for ASFV provides a platform for rational modification of War-076 within the viral genome . This allows generation of attenuated vaccine candidates with specific modifications to War-076.

    • Subunit Vaccine Approaches: Purified recombinant War-076 can be formulated with adjuvants to evaluate immune responses. Consider combining with other ASFV antigens for broader protection.

    • Vectored Vaccines: Expressing War-076 in viral vectors (adenovirus, Modified Vaccinia Ankara) to induce cellular and humoral immunity.

    • DNA Vaccines: Plasmid-based delivery of War-076 coding sequences, potentially codon-optimized for expression in porcine cells.

    • Structure-Based Design: Using structural information to engineer War-076 variants with enhanced immunogenicity while maintaining critical epitopes.

    Vaccine efficacy evaluation should include both antibody production and T-cell response metrics, as both arms of adaptive immunity may be required for protection against ASFV .

  • What techniques can resolve the structure-function relationship of War-076 in ASFV pathogenesis?

    Deciphering structure-function relationships requires integrating computational and experimental approaches:

    • Structural Determination:

      • X-ray crystallography of purified War-076 (requiring milligram quantities of highly pure protein)

      • Cryo-electron microscopy for visualization within virions or membrane complexes

      • NMR spectroscopy for dynamic regions and ligand interactions

    • Computational Analyses:

      • Molecular dynamics simulations to predict membrane interactions

      • Homology modeling based on related viral proteins

      • Epitope prediction algorithms to identify immunogenic regions

    • Functional Mapping:

      • Alanine scanning mutagenesis to identify critical residues

      • Domain swapping with homologous proteins from related viruses

      • Chimeric constructs to define functional domains

    • In vivo Validation:

      • Targeted mutations in the C257L gene using reverse genetics systems

      • Evaluation of mutant virus phenotypes in cell culture and animal models

    Correlating structural features with functional outcomes provides rational targets for antiviral development and vaccine design strategies against ASFV.

  • How does War-076 compare functionally across different ASFV isolates and genotypes?

    Comparative analysis of War-076 across ASFV variants reveals evolutionary patterns and functional conservation:

    ASFV Isolate/GenotypeWar-076 HomologSequence Identity (%)Key Functional DifferencesVirulence Correlation
    Warthog/Namibia/Wart80/1980C257L (reference)100Reference sequenceModerate virulence in wild hosts
    Other genotypes[Would need sequence data][Varies by isolate][Would be determined by research][Correlation with virulence]

    Research approaches for comparative analysis should include:

    • Sequence alignment of C257L homologs across all available ASFV genomes

    • Phylogenetic analysis to determine evolutionary relationships

    • Functional complementation studies using reverse genetics

    • Cross-neutralization experiments with antibodies raised against different variants

    • Structural comparison of War-076 homologs to identify conserved epitopes

    This comparative approach provides insight into which regions of War-076 are evolutionarily constrained and therefore potential targets for broad-spectrum interventions or diagnostic development.

  • What challenges exist in incorporating War-076 into ASFV reverse genetics systems?

    The implementation of War-076 modifications in reverse genetics systems presents several technical challenges that must be addressed methodologically:

    • Genomic Context Dependencies: War-076 modifications may affect viral genome packaging or replication through interactions with other viral components. Solution: Use complementation assays to identify potential dependencies before attempting whole genome modifications.

    • Protein Expression Timing: Alterations in War-076 expression kinetics may disrupt viral life cycle. Solution: Employ inducible expression systems to fine-tune expression timing in the reverse genetics platform.

    • Structural Integrity: Modifications to War-076 may disrupt protein folding or complex formation. Solution: Conduct structural predictions before introducing mutations and validate protein expression in isolation.

    • Host Range Effects: War-076 variants may alter viral tropism. Solution: Test modified viruses in multiple relevant cell types including porcine macrophages and established cell lines.

    • Assembly Integration: The recently developed reverse-genetics system for ASFV involves synthetic DNA construction, yeast-based assembly, E. coli propagation, and mammalian cell transfection followed by self-helper virus infection . Each step presents optimization challenges when manipulating War-076.

    The systematic application of the reverse genetics platform developed by JCVI, FLI, and ILRI researchers represents a significant advancement that will enable these challenges to be addressed through controlled experimentation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.