Recombinant African swine fever virus Transmembrane protein C257L (Ba71V-066)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant African Swine Fever Virus Transmembrane Protein C257L (Ba71V-066)

Recombinant African swine fever virus Transmembrane protein C257L (Ba71V-066) refers to a protein encoded by the C257L gene in the African swine fever virus (ASFV) . The ASFV is a large, complex DNA virus that causes African swine fever, a highly lethal disease affecting domestic pigs and wild boars .

  • C257L is described as a putative structural protein with a single transmembrane segment, but its precise function remains unknown .

  • The protein is highly conserved across various ASFV genotypes .

  • Experiments suggest C257L is essential for the ASFV life cycle .

Genetic Characteristics of C257L in ASFV

The C257L gene exhibits specific genetic signatures and variations that influence ASFV virulence and stability.

  • Sequence Conservation: The C257L gene is highly conserved at the protein level across various ASFV genotypes, as revealed by examining numerous ASFV C257L genes available in GenBank .

  • Mutations and Virulence: Mutations in the C257L protein may play a significant role in the reversion to virulence of modified ASFV strains. For example, the ASFV-G-ΔI177L strain showed mutations in the C257L gene during in vivo passaging, correlating with increased viremia and ASF-related clinical signs .

  • Specific Nucleotide Changes: Specific nucleotide changes in the C257L gene, such as cytosine to thymine transitions at position 86868 and deletions in the homopolymer stretch of thymine residues at position 87231–87237, have been identified . These mutations can result in amino acid changes, such as glutamic acid to lysine substitutions and lysine deletions in the C257L protein .

  • Compensatory Mutations: Mutations in C257L might be compensatory, facilitating viral infection in the absence of other proteins like I177L .

  • Essentiality: Attempts to create C257L knock-out viruses have been unsuccessful, indicating that the C257L gene is essential for the ASFV life cycle .

Role of C257L in ASFV Virulence and Attenuation

Variations in the C257L gene can impact ASFV virulence.

  • Attenuated Strains: Attenuated ASFV strains often have specific modifications or deletions. For instance, deletion of the viral CD2v (EP402R) gene in the virulent BA71 strain results in a highly attenuated virus (BA71ΔCD2) .

  • Reversion to Virulence: Modified-live ASFV strains can revert to virulence through mutations in genes like C257L. The ASFV-G-ΔI177L strain reverted to virulence with mutations occurring in the C257L gene during in vivo passages .

  • Impact on Viral Replication: Changes in the C257L protein can affect viral replication fitness. For example, a G-to-A nucleotide change at position 87056 in the C257L protein of the ASFV-G-ΔI177L strain resulted in a methionine to threonine change, potentially increasing replication fitness .

C257L as a Potential Vaccine Target

The C257L protein's essential nature and its impact on virulence make it a potential target for vaccine development.

Research Techniques and Findings

Research into ASFV and its proteins, including C257L, involves various techniques and methodologies.

  • Genome Sequencing: Sequencing the ASFV genome helps identify mutations and variations in genes like C257L . For example, sequencing of the BA71V strain revealed specific deletions and changes in genes affecting virulence .

  • In Vivo Passaging: In vivo passaging experiments involve infecting animals with modified ASFV strains and observing changes in virulence and viral replication over successive passages . These experiments can reveal mutations that contribute to reversion to virulence.

  • Mutation Analysis: Analyzing mutations in genes like C257L helps understand their impact on protein function and viral behavior. Techniques such as PCR amplification, cloning, and sequencing are used to identify and characterize these mutations .

  • CRISPR/Cas9-mediated homologous recombination: This gene editing technique is used to create knockout mutants to study the essentiality and function of specific genes like C257L .

Comparative Analysis of ASFV Strains

Different ASFV strains exhibit variations in their genetic makeup and virulence.

  • BA71V: The BA71V strain, a derivative of the virulent BA71 strain, is attenuated and has been used in research to understand ASFV genetics and virulence .

  • E75: A virulent strain, E75, is often used as a challenge virus to test the efficacy of ASFV vaccine candidates .

  • Georgia 2007/1: This genotype II strain is currently circulating in continental Europe and is used to assess the cross-protective capabilities of ASFV vaccine candidates .

Impact on Host Immune Response

ASFV's interaction with the host immune system is crucial in determining the outcome of infection.

  • Type I Interferon (IFN) Production: ASFV proteins can inhibit type I interferon production, which is a critical component of the host's antiviral response . For instance, the ASFV H240R protein inhibits type I IFN production by targeting STING .

  • CD8+ T Cells: Induction of CD8+ T cells is associated with protection against ASFV . The BA71ΔCD2 virus induces specific CD8+ T cells capable of recognizing both BA71 and E75 viruses in vitro .

Data Table Summarizing Key ASFV Vaccine Studies

Vaccine CandidateVirus StrainProtection Against Challenge StrainCross-ProtectionKey FindingsReference
BA71ΔCD2BA71BA71E75, Georgia/07Deletion of CD2v gene attenuates BA71, providing protection against homologous and heterologous strains. Cross-protection correlates with the induction of cross-reactive CD8+ T cells.
ASFV-G-ΔI177LASFV-GNot specifiedNoModified-live virus strain can revert to virulence via mutations in the C257L gene. Mutations in C257L may compensate for the absence of other proteins (I177L) and increase replication fitness.
H240R Deletion MutantNot specifiedNot specifiedNot specifiedDeletion of the H240R gene reduces viral pathogenicity by enhancing type I interferon production, which decreases ASFV replication. H240R protein inhibits type I IFN production by targeting STING.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ba71V-066; C257L; Transmembrane protein C257L; pC257L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Target Names
Ba71V-066
Target Protein Sequence
MYSVCDVVRDAVAQSHLCACPNDKLPQCKGVTKAPPKCSVFHVAKLQDTKFKWKYTLDPL KAQKLSQIDKDIEKDAITLKLIYGIELSPEDLEWWKMQRCLINKKTGAKGGQFANKYLER QDLELLGYSPTPIIGGDFMFTALPDKVLRTIPVAWDRFLNPAMMIFFLIILLCVILGIFY VLVRNTLRRKQKSKQHQMEIKRFIKEKEQDPYIHTSFESWPADPNKKWKDLIPMYEAQGY CMADYRKKLGMPPGPNC
Uniprot No.

Target Background

Database Links

KEGG: vg:22220296

Protein Families
Asfivirus C257R family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the African swine fever virus transmembrane protein C257L (Ba71V-066)?

C257L (Ba71V-066) is a transmembrane protein derived from the African swine fever virus strain Badajoz 1971 Vero-adapted (Ba71V). It belongs to the ASFV proteome and is available as a recombinant protein expressed in E. coli systems. The protein is cataloged in UniProt under ID Q65158. ASFV belongs to the Asfarviridae family and is endemic to sub-Saharan Africa, where it maintains a natural cycle of infection between ticks and wild pigs, including bushpigs and warthogs . The clinical presentation of ASFV infection closely resembles that of classical swine fever, necessitating laboratory diagnostics for definitive identification.

How does C257L contribute to ASFV virulence and genetic stability?

Recent research has identified C257L mutations as potential drivers of increased replication fitness and virulence in ASFV strains. In studies of the ASFV-G-ΔI177L vaccine strain, C257L mutations were associated with reversion to virulence during in vivo passaging experiments. By passage 3 and 4, the previously attenuated virus demonstrated severe ASF-specific clinical signs and increased viremia, with whole genome sequencing confirming C257L mutations as a likely contributor to this phenotypic change . This finding suggests that C257L plays a critical role in viral fitness and should be carefully monitored in attenuated vaccine candidates.

What expression systems are recommended for recombinant C257L production?

For laboratory research purposes, E. coli expression systems have been successfully employed to produce recombinant C257L (Ba71V-066) protein . When implementing this approach, researchers should consider optimizing codon usage for bacterial expression, as viral codon preferences may differ significantly. Standard protein purification techniques including affinity chromatography (His-tag or GST-tag based systems) can be applied, followed by size exclusion chromatography to improve purity. For functional studies requiring proper transmembrane domain folding, mammalian or insect cell expression systems may provide advantages over bacterial systems, though with potentially lower yields.

What are the recommended protocols for functional characterization of C257L?

Functional characterization of C257L should begin with in silico analysis of protein domains, followed by experimental validation. For transmembrane domain characterization, combining computational prediction tools with experimental approaches is advised. Circular dichroism spectroscopy can confirm secondary structure elements, while proteoliposome reconstitution can help study membrane insertion properties. For functional studies, researchers should consider:

  • Site-directed mutagenesis to identify critical residues

  • Protein-protein interaction studies using co-immunoprecipitation or yeast two-hybrid systems

  • Localization studies using fluorescently tagged proteins in infected cells

  • Host response studies measuring effects on cellular pathways

When investigating potential roles in virulence, comparing wild-type and mutant C257L effects on viral replication kinetics in primary porcine macrophages provides valuable insights.

How can researchers assess the role of C257L mutations in vaccine strain reversion to virulence?

To assess C257L's role in virulence reversion, researchers should implement a systematic approach combining in vitro and in vivo methodologies:

  • Generate defined C257L mutants using reverse genetics systems

  • Evaluate growth kinetics in porcine alveolar macrophages (PAMs)

  • Conduct controlled in vivo passaging experiments with careful monitoring of clinical parameters

  • Perform whole genome sequencing at each passage to detect emergent mutations

  • Validate candidate mutations through introduction into attenuated backbones

In the ASFV-G-ΔI177L vaccine strain study, virulence reversion was observed during passages 3 and 4, with severe ASF-specific clinical signs and increased viremia . This timeline provides a benchmark for passaging experiments. Additionally, pregnant animal models should be included to comprehensively assess safety profiles, as ASFV-G-ΔI177L demonstrated concerning reproductive impacts including 43% stillbirths and only 17% survival among live-born piglets from vaccinated sows .

How does the function of C257L compare with other ASFV transmembrane proteins such as pE66L?

While limited direct comparative data exists, contrasting C257L with other ASFV transmembrane proteins provides important research context. The transmembrane protein pE66L has been characterized as a potent inhibitor of host gene expression, with its transmembrane domain (amino acids 13-34) being essential for this function . This domain appears to facilitate localization to the endoplasmic reticulum, where it suppresses translation through the PKR/eIF2α pathway .

Unlike pE66L, which primarily functions in host shutoff mechanisms, C257L appears more directly involved in viral fitness and virulence characteristics . Comprehensive comparative studies should examine:

  • Cellular localization patterns

  • Effects on host cellular pathways

  • Temporal expression during infection

  • Contributions to virion structure

  • Conservation across ASFV isolates

Such studies would clarify the distinct and overlapping functions of these transmembrane proteins within the viral replication cycle.

What structural insights can be derived from proteomic analyses of C257L compared to other virion proteins?

Proteomic analyses of ASFV virions have identified multiple structural and functional proteins. When analyzing C257L in this context, researchers should consider its position within the virion architecture relative to core shell proteins like p37, p14, and p35 (derived from polyproteins pp220 and pp62) . Based on partial proteomic data, these core shell proteins range in size from 11.6 to 41.5 kDa with varying isoelectric points .

A methodological approach to structural characterization should include:

  • Mass spectrometry-based identification of C257L in purified virions

  • Immunoelectron microscopy to locate C257L within the virion structure

  • Cryo-electron microscopy for higher-resolution structural determination

  • Cross-linking mass spectrometry to identify interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to map flexible domains

What role does C257L play in the development of attenuated ASFV vaccines?

The role of C257L in vaccine development is primarily cautionary, as mutations in this protein have been associated with reversion to virulence in attenuated ASFV vaccine candidates . This finding suggests that vaccine development strategies should:

  • Consider genetic stabilization of C257L in attenuated candidates

  • Implement monitoring of C257L sequences during passaging studies

  • Evaluate alternative attenuation approaches that do not risk C257L-mediated reversion

In contrast, the CD2v (EP402R) gene deletion has shown promise as an attenuation strategy. The BA71ΔCD2 strain demonstrated dose-dependent protection against homologous BA71 challenge with the following efficacy:

BA71ΔCD2 Dose (PFU)Protection Rate Against BA71Viremia Status Post-Challenge
10^333% (2/6 pigs)Detected in non-protected animals
3.3 × 10^4100% (6/6 pigs)Not detected
10^6100% (6/6 pigs)Not detected

Additionally, this attenuated strain conferred cross-protection against heterologous challenges with E75 (genotype I) and Georgia 2007/1 (genotype II) strains . Unlike C257L mutations, the CD2v deletion appears to create a stable attenuation that doesn't readily revert to virulence, making it potentially more suitable for vaccine development.

How can researchers assess the stability of C257L in attenuated vaccine candidates?

To comprehensively assess C257L stability in attenuated vaccine candidates, researchers should implement:

  • Sequential in vitro passaging in porcine alveolar macrophages (minimum 20 passages)

  • Deep sequencing at regular intervals to detect minor variant populations

  • In vivo passaging in pigs (3-5 sequential passages)

  • Combined approach examining both C257L sequence and phenotypic virulence

  • Stress-testing under suboptimal conditions (temperature fluctuations, growth limitations)

The ASFV-G-ΔI177L reversion study demonstrated that virulence can return within just 3-4 animal passages, highlighting the importance of thorough stability assessment . Particular attention should be paid to pregnant animal models, as these may reveal safety concerns not apparent in standard models.

What mechanisms underlie C257L contribution to viral fitness and virulence?

The molecular mechanisms by which C257L mutations enhance viral fitness and contribute to virulence remain incompletely characterized. Researchers investigating this question should consider several hypothetical mechanisms:

  • Enhanced viral entry through altered membrane fusion properties

  • Modified interactions with host cellular receptors

  • Altered cellular tropism affecting viral dissemination

  • Evasion of host immune responses through structural changes

  • Enhanced stability of viral particles in environmental conditions

Methodologically, researchers could employ:

  • CRISPR-engineered porcine macrophage lines to identify host factors

  • Live-cell imaging with fluorescently labeled virions containing wild-type or mutant C257L

  • Comparative transcriptomics/proteomics of cells infected with variant viruses

  • In vitro evolution experiments under selective pressure

  • Ex vivo organ culture systems to assess tissue tropism differences

How do C257L interactions with host factors compare between resistant and susceptible pig breeds?

African wild suids like warthogs and bushpigs show resistance to clinical ASFV disease despite viral replication, while domestic pigs experience high mortality . This differential susceptibility provides a natural model to investigate C257L-host interactions. Researchers could:

  • Compare C257L binding partners in macrophages derived from resistant and susceptible pig breeds

  • Examine post-translational modifications of C257L in different cellular environments

  • Investigate differential membrane localization patterns between cell types

  • Assess the impact of C257L expression on cellular immune signaling pathways

  • Evaluate whether polymorphisms in potential host receptors correlate with disease resistance

Such comparative studies might reveal critical interactions that could be targeted for therapeutic intervention or guide breeding programs for enhanced disease resistance.

What are the most effective in vitro systems for studying C257L function?

When designing experiments to study C257L function, researchers should consider these methodological approaches:

  • Primary Cell Systems: Porcine alveolar macrophages (PAMs) represent the most physiologically relevant system, though they present challenges in standardization and maintenance. Protocols should include magnetic bead isolation of CD163+ macrophages from porcine lung lavage, with culture in RPMI-1640 supplemented with 10% porcine serum and appropriate antibiotics.

  • Cell Lines: While less physiologically relevant, macrophage-like cell lines such as 3D4/2 or IPAM offer greater reproducibility for mechanistic studies. COS-1 cells have also been validated for ASFV growth without compromising genetic stability, pathogenicity, or immunogenicity .

  • Expression Systems: For protein interaction studies, mammalian expression systems using porcine cell lines will provide more relevant post-translational modifications than bacterial systems.

  • Viral Genetic Manipulation: CRISPR/Cas9-based editing of viral genomes in conjunction with homologous recombination offers precise manipulation of C257L sequences.

What controls and validations are essential when studying C257L mutations in virulence reversion?

To ensure rigorous experimental design when studying C257L's role in virulence reversion, researchers should implement:

  • Genetic Controls:

    • Revertant viruses where mutations are corrected to wild-type sequence

    • Viruses with synonymous mutations to control for nucleotide-specific effects

    • Panel of viruses with individual point mutations to identify critical residues

  • Phenotypic Validation:

    • In vitro growth curves in PAMs

    • Cytopathic effect quantification

    • Multi-step growth curves comparing different cell types

    • Protein expression analysis at different time points

  • In Vivo Validation:

    • Dose titration studies (10^2 to 10^6 PFU range)

    • Time-course sampling of multiple tissues

    • Immunological parameter assessment (both humoral and cellular responses)

    • Clinical scoring systems standardized across experiments

When analyzing virulence reversion, parallel sequencing of multiple independent lineages helps distinguish between random mutations and selected adaptive changes.

What are the most pressing knowledge gaps regarding C257L function and applications?

Despite advancing understanding of C257L's role in ASFV biology, significant knowledge gaps remain that warrant focused research attention:

  • The three-dimensional structure of C257L remains unresolved, limiting structure-based function predictions

  • The precise molecular interactions between C257L and host factors are largely uncharacterized

  • The evolutionary conservation and variation of C257L across ASFV isolates requires systematic analysis

  • The potential of C257L as a diagnostic marker or therapeutic target needs evaluation

  • The mechanisms by which C257L mutations contribute to virulence reversion require elucidation

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, immunology, virology, and genomics methodologies.

How might C257L research contribute to broader understanding of viral transmembrane proteins?

Research on C257L has implications beyond ASFV vaccine development, potentially contributing to fundamental understanding of viral transmembrane proteins. Comparative analysis with other viral transmembrane proteins may reveal conserved structural features and functional mechanisms. For instance, the role of transmembrane domains in host shutoff mechanisms, as observed with pE66L , may represent a broader strategy employed by various viruses. Methodologically, the approaches developed to study C257L stability and function could serve as templates for investigating transmembrane proteins in other complex viruses that lack robust reverse genetics systems.

The research on C257L mutations in ASFV-G-ΔI177L vaccine reversion also highlights the broader challenge of genetic stability in live attenuated viral vaccines, providing valuable lessons for vaccine development across viral families. Understanding how transmembrane protein mutations contribute to fitness restoration could inform stabilization strategies for other attenuated vaccine platforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.