Recombinant African swine fever virus Uncharacterized protein A118R (Ba71V-035)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant African Swine Fever Virus Uncharacterized Protein A118R (Ba71V-035)

The Recombinant African Swine Fever Virus Uncharacterized Protein A118R (Ba71V-035) is a specific protein derived from the African Swine Fever Virus (ASFV), which is a highly contagious and lethal disease affecting pigs. ASFV is a complex virus with a large genome, encoding numerous proteins, some of which remain uncharacterized. The protein A118R is one such uncharacterized protein, and its recombinant form, Ba71V-035, is of interest for research purposes.

Background on African Swine Fever Virus

African Swine Fever Virus (ASFV) is a member of the Asfarviridae family and is known for causing African Swine Fever, a disease with a high mortality rate in pigs, reaching up to 100% in some cases . The virus has multiple strains, including the virulent BA71 and its attenuated form, BA71V, which has been extensively studied for vaccine development .

Characteristics of Recombinant African Swine Fever Virus Uncharacterized Protein A118R (Ba71V-035)

  • Chemical Properties: Detailed chemical properties such as molecular formula and molecular weight for Recombinant African Swine Fever Virus Uncharacterized Protein A118R (Ba71V-035) are not readily available in the current literature .

  • Preparation and Suppliers: This protein is prepared using recombinant DNA technology and is available from suppliers like CUSABIO TECHNOLOGY LLC .

References

  1. Recombinant African Swine Fever Virus Uncharacterized Protein A118R (Ba71V-035): Information on this protein is primarily available through suppliers and lacks detailed scientific literature .

  2. African Swine Fever Virus Research: Studies on ASFV, particularly its virulent and attenuated strains, provide insights into viral mechanisms and vaccine development .

  3. Vaccine Development: Efforts to develop effective vaccines against ASFV involve modifying viral strains to induce protective immunity without causing disease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ba71V-035; A118R; Uncharacterized protein A118R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Target Names
Ba71V-035
Target Protein Sequence
MHSNAFFNLIACVLFPTPLIPSMVISIPRMINKWVKRVQFLTFLTNLFLYNIVQHYINRI RCYSFIKYLLLYNLYRPIFGRSLQMAITKIKIISDATAAVLLKSCAAMYDVLIDKKFK
Uniprot No.

Target Background

Database Links

KEGG: vg:22220418

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Ba71V-035 protein and what is its role in African swine fever virus?

Ba71V-035, also known as uncharacterized protein A118R, is a protein encoded by the African swine fever virus (ASFV), specifically from the strain Badajoz 1971 Vero-adapted (Ba71V). It consists of 118 amino acids and has been assigned the UniProt ID Q65139 . ASFV belongs to the Asfarviridae family and is endemic to sub-Saharan Africa, where it exists in a cycle of infection between ticks and wild pigs, bushpigs, and warthogs . Despite being identified, the specific function of Ba71V-035 in viral replication, pathogenesis, or host immune evasion remains largely uncharacterized, hence its designation as an "uncharacterized protein."

How can researchers express and purify recombinant Ba71V-035 protein?

Recombinant Ba71V-035 protein can be expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . A standardized protocol involves:

  • Cloning the Ba71V-035 gene (entire coding sequence of 118 amino acids) into an appropriate expression vector with a His-tag

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Lysing the cells and purifying the protein via nickel affinity chromatography

  • Performing buffer exchange to remove imidazole

  • Lyophilizing the purified protein for long-term storage

The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C or -80°C .

What are the recommended storage conditions for maintaining the stability of recombinant Ba71V-035 protein?

The recombinant Ba71V-035 protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For optimal stability:

  • Store the lyophilized protein at -20°C or -80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 5-50% (with 50% being standard)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C or -80°C

Repeated freezing and thawing should be avoided as it can compromise protein integrity and activity .

How can Ba71V-035 protein be incorporated into diagnostic assays for ASFV detection?

While specific information about Ba71V-035's use in diagnostics is limited, the methodological approach would include:

  • Antibody Development: Generate monoclonal or polyclonal antibodies against recombinant Ba71V-035 protein

  • ELISA Development: Utilize these antibodies in an enzyme-linked immunosorbent assay (ELISA) format for detecting either the viral protein or host antibodies against it

  • PCR-Based Detection: Design primers targeting the Ba71V-035 gene sequence for PCR-based viral detection

  • Field Application Optimization: Adapt the assay for portable or field-deployable formats

Researchers should compare the sensitivity of Ba71V-035-based assays with established diagnostic methods that can detect ASFV DNA at early stages of infection (within 3-4 days) using PCR or antibodies 7-14 days post-infection using ELISA . For field applications, novel approaches like the dual quantum dot microsphere (QDM) probes technology, which allows for a 25-minute ASFV field detection test, could potentially be adapted for Ba71V-035 .

What methodologies can be employed to investigate the function of the uncharacterized Ba71V-035 protein?

To elucidate the function of this uncharacterized protein, researchers can implement a multi-faceted approach:

  • Structural Analysis: Determine the three-dimensional structure using X-ray crystallography or cryo-electron microscopy to gain insights into potential functional domains

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify viral or host binding partners

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

  • Gene Knockout/Knockdown:

    • Generate ASFV variants lacking the Ba71V-035 gene

    • Assess the impact on viral replication, morphogenesis, and pathogenicity

  • Transcriptomic Analysis: Examine expression patterns of Ba71V-035 during different stages of viral infection to determine if it exhibits early or late gene characteristics, similar to the temporal expression analyses performed for other ASFV genes like I243L

  • Comparative Genomics: Analyze the conservation of Ba71V-035 across different ASFV strains (virulent vs. avirulent) to infer functional importance, similar to analyses that identified 126 ORFs present in both virulent (GRG2007, HG2018, HLJ2018) and avirulent strains (BA71V, OURT88/3)

How does the expression profile of Ba71V-035 compare to other ASFV genes during infection?

While specific expression data for Ba71V-035 is not directly provided in the search results, researchers can employ similar methodologies as used for other ASFV genes:

  • Temporal Expression Analysis: Monitor Ba71V-035 expression at different time points post-infection to classify it as an early, late, or constant gene, similar to the categorization that identified 68 early genes, 70 late genes, and 44 constant genes in previous ASFV studies

  • Strain Comparison: Compare Ba71V-035 expression levels across different ASFV strains (virulent vs. avirulent) to identify potential correlations with virulence, as observed in the expression pattern differences between strains like HLJ2018, GRG2007, HG2018, and BA71V

  • Quantitative Analysis: Determine the relative expression level of Ba71V-035 compared to highly expressed genes (like I73R and K78R) or lowly expressed genes (like I215L and E423R)

  • Real-Time PCR: Design specific primers for Ba71V-035 to quantify its expression at different infection stages

What approaches can be used to evaluate Ba71V-035 as a potential vaccine candidate against ASFV?

To assess Ba71V-035's potential as a vaccine component, researchers should implement a systematic evaluation protocol:

  • Immunogenicity Assessment:

    • Determine whether Ba71V-035 induces both humoral and cell-mediated immune responses

    • Characterize the antibody response (isotype, neutralizing capacity)

    • Evaluate T cell activation and cytokine production

  • Comparative Immunogenicity:

    • Compare immune responses to Ba71V-035 with those elicited by established ASFV immunogens such as CP204L (p30), CP530R (pp62), E183L (p54), B646L (p72), and EP402R (CD2v)

  • Vector-Based Expression:

    • Incorporate Ba71V-035 into viral vectors like pseudorabies virus (PRV), similar to the approach used for other ASFV antigens

    • Evaluate expression stability over multiple cell culture passages

    • Assess genetic stability using sequencing after multiple passages

  • Challenge Studies:

    • Immunize animals (mice for preliminary studies, pigs for validation)

    • Perform challenge experiments with virulent ASFV strains

    • Monitor protection levels, viral loads, and clinical parameters

How can researchers optimize recombinant vector systems to express Ba71V-035 for vaccine applications?

Based on successful approaches with other ASFV antigens, the following methodology is recommended:

  • Vector Selection: Choose an appropriate viral vector system, such as the pseudorabies virus (PRV) Bartha-K61 strain, which has demonstrated successful expression of other ASFV antigens

  • Insertion Site Optimization: Target specific sites in the vector genome, such as the thymidine kinase (TK) gene locus, which has been used successfully for inserting ASFV genes

  • Promoter Selection: Utilize strong promoters like the CMV promoter to drive high-level expression of Ba71V-035

  • Recombination Technology: Employ Red/ET recombineering technology for precise DNA modification without restriction enzyme site limitations, allowing for accurate insertion of the Ba71V-035 gene into the vector

  • Expression Verification: Confirm expression of Ba71V-035 through Western blot analysis using specific antibodies

  • Stability Assessment: Evaluate genetic stability through continuous passage in cell culture (e.g., 15-20 generations in PK15 cells) and sequence verification

What are the common challenges in expressing and purifying Ba71V-035, and how can they be addressed?

Researchers working with recombinant Ba71V-035 may encounter several technical challenges:

  • Protein Solubility Issues:

    • Challenge: Recombinant viral proteins often form inclusion bodies in E. coli

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration), use solubility-enhancing tags, or develop refolding protocols from inclusion bodies

  • Conformational Integrity:

    • Challenge: Maintaining the native conformation of Ba71V-035 during expression and purification

    • Solution: Consider eukaryotic expression systems (insect or mammalian cells) that provide appropriate post-translational modifications and folding environments

  • Protein Stability:

    • Challenge: Protein degradation during purification or storage

    • Solution: Include protease inhibitors during purification, optimize buffer composition (add stabilizing agents like trehalose), and store with 50% glycerol at -80°C

  • Functional Validation:

    • Challenge: Confirming that the recombinant protein retains biological activity

    • Solution: Develop functional assays based on interaction partners or predicted functions from structural analysis

How can researchers distinguish between genuine experimental findings and artifacts when studying the poorly characterized Ba71V-035 protein?

When investigating uncharacterized proteins like Ba71V-035, distinguishing real biological effects from experimental artifacts requires robust experimental design:

  • Multiple Detection Methods:

    • Employ at least two independent techniques to verify protein expression, localization, or interactions

    • Combine biochemical approaches with imaging techniques

  • Appropriate Controls:

    • Include both positive and negative controls in all experiments

    • Use isotype controls for antibody-based experiments

    • Include empty vector controls for expression studies

  • Validation Across Systems:

    • Confirm findings in multiple cell types or experimental systems

    • Verify results in both in vitro and in vivo systems when possible

  • Biological Replicates:

    • Perform experiments with at least three biological replicates

    • Apply appropriate statistical analyses to evaluate significance

  • Cross-Validation:

    • Compare results with those obtained for better-characterized ASFV proteins

    • Evaluate consistency with known viral biology and pathogenesis

What emerging technologies could advance our understanding of Ba71V-035's role in ASFV biology?

Several cutting-edge approaches could significantly enhance our knowledge of this uncharacterized protein:

  • CRISPR-Cas9 Genome Editing:

    • Generate precise mutations or deletions of Ba71V-035 in the ASFV genome

    • Create reporter-tagged versions of the protein for live-cell imaging

    • Develop conditional expression systems to control Ba71V-035 expression

  • High-Resolution Imaging:

    • Apply super-resolution microscopy to track Ba71V-035 localization during viral infection

    • Use correlative light and electron microscopy to visualize Ba71V-035 in the context of viral factories and morphogenesis

  • Single-Cell Omics:

    • Apply single-cell transcriptomics to understand cell-to-cell variability in Ba71V-035 expression

    • Use spatial transcriptomics to map Ba71V-035 expression in infected tissues

  • Proteomics Approaches:

    • Employ proximity labeling to identify the Ba71V-035 interactome

    • Use crosslinking mass spectrometry to map structural interactions

    • Apply thermal proteome profiling to identify drug interactions or conformational changes

  • Computational Approaches:

    • Use machine learning algorithms to predict function based on sequence or structural features

    • Apply molecular dynamics simulations to model protein behavior

How might Ba71V-035 contribute to the development of next-generation ASFV vaccines or diagnostics?

While Ba71V-035's exact function remains unclear, it could play important roles in future ASFV control strategies:

  • Multivalent Vaccine Development:

    • Incorporate Ba71V-035 into multivalent vaccine formulations alongside established immunogens

    • Evaluate whether inclusion of Ba71V-035 enhances breadth of protection against diverse ASFV strains

    • Assess potential for DIVA (Differentiating Infected from Vaccinated Animals) applications

  • Novel Diagnostic Approaches:

    • Develop Ba71V-035-based rapid diagnostics for field use, potentially building on technologies like the portable real-time recombinase-aided amplification assay (20-30 minute detection time) or recombinase polymerase amplification-CRISPR assay

    • Explore its utility in multiplex detection systems with other ASFV proteins

  • Therapeutic Target Identification:

    • Investigate whether Ba71V-035 could serve as a target for antiviral drug development

    • Screen for small molecules that specifically interact with or inhibit Ba71V-035

  • Immunomodulation Studies:

    • Evaluate whether Ba71V-035 possesses immunomodulatory properties that could be exploited for vaccine adjuvant development

    • Assess its impact on host innate immune responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.