Recombinant Agelenopsis aperta Omega-agatoxin-Aa3d

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Omega-agatoxin-Aa3d is a 48-amino acid peptide toxin with the sequence SCIKIGEDCDGDKDDCQCCRTNGYCSXYXLFGYLKSG . It features:

  • Disulfide bond framework: A conserved cysteine-knot motif (C-C-CC-C-C) stabilizing its tertiary structure .

  • Post-translational modifications: Includes γ-hydroxyproline substitutions and C-terminal amidation, enhancing stability .

  • Net charge: Positively charged due to multiple lysine and arginine residues, facilitating interaction with Ca<sub>v</sub>2.2 channels .

Pharmacological Profile

PropertyValue/DescriptionReference
Target channelCa<sub>v</sub>2.2 (N-type)
IC<sub>50</sub>35 nM (rat brain synaptosomes)
SelectivityNon-selective (activity at Ca<sub>v</sub>1, Ca<sub>v</sub>2.1, Ca<sub>v</sub>2.3)
ReversibilityVoltage-dependent, influenced by auxiliary subunits

Mechanism of Action

Omega-agatoxin-Aa3d acts as a pore blocker rather than a gating modifier:

  • Binds to the outer vestibule of Ca<sub>v</sub>2.2, interacting with residues Gly1326, Glu1332, and Glu1334 .

  • Displaces radiolabeled ω-conotoxin GVIA, suggesting overlapping binding sites with cone snail toxins .

  • Shows reduced efficacy in the presence of α2δ1 and β3 auxiliary subunits .

Applications and Limitations

  • Research tool: Used to study Ca<sub>v</sub>2.2’s role in pain signaling and neurotransmitter release .

  • Therapeutic potential: Limited by non-selectivity across Ca<sub>v</sub> isoforms .

  • Production challenges: Recombinant expression requires eukaryotic systems to preserve disulfide bonds .

  • Selectivity engineering: Mutagenesis studies targeting residues 13 (tyrosine) and 25 (arginine) to enhance Ca<sub>v</sub>2.2 specificity .

  • Auxiliary subunit effects: Systematic analysis of β-subunit interactions required to optimize therapeutic profiles .

Product Specs

Form
Lyophilized powder. We may ship other formats if available. If you have specific format requirements, please note them when ordering.
Lead Time
Delivery times vary by purchase method and location. Consult your local distributor for specifics. Proteins are shipped with blue ice packs by default. Request dry ice in advance for an additional fee.
Notes
Avoid repeated freeze-thaw cycles. Working aliquots are stable at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening. Reconstitute in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer, temperature, and protein stability. Liquid form is generally stable for 6 months at -20°C/-80°C. Lyophilized form is generally stable for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you have a specific tag requirement, please inform us and we will prioritize its development.
Synonyms
; Omega-agatoxin-Aa3d; Omega-AGTX-Aa3d; Omega-agatoxin IIID; Omega-Aga-IIID; Omega-agatoxin-3D; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-37
Protein Length
full length protein
Purity
>85% (SDS-PAGE)
Species
Agelenopsis aperta (North American funnel-web spider) (Agelenopsis gertschi)
Target Protein Sequence
SCIKIGEDCD GDKDDCQCCR TNGYCSXYXL FGYLKSG
Uniprot No.

Target Background

Function
Omega-agatoxins are voltage-gated calcium channel antagonists. This toxin blocks calcium channels in insect central neurons but not peripheral neuromuscular junctions. In vertebrates, it broadly inhibits Cav1/CACNA1 and Cav2.2/CACNA1B channels.
Protein Families
Omega-agatoxin superfamily, Type II/III omega-agatoxin family
Subcellular Location
Secreted.
Tissue Specificity
Expressed by the venom gland.

Q&A

What is Omega-agatoxin-Aa3a and how does it compare to other agatoxin variants?

Omega-agatoxin-Aa3a (Omega-AGTX-Aa3a) is a 76-amino acid peptide toxin isolated from the venom of Agelenopsis aperta, also known as the North American funnel-web spider. It belongs to the Type III ω-agatoxins family and contains 12 cysteine residues that form six internal disulfide bonds, with an amidated C-terminus . Its full amino acid sequence is: SCIDIGGDCD GEKDDCQCCR RNGYCSCYSL FGYLKSGCKC VVGTSAEFQG ICRRKARQCY NSDPDKCESH NKPKRR .

Type III ω-agatoxins, including ω-agatoxin-Aa3a, differ from Type IV ω-agatoxins in their structure, size, and specificity. While Type III ω-agatoxins are approximately 8.5 kDa in mass and have broader inhibitory effects across multiple calcium channel types, Type IV ω-agatoxins are more selective for P/Q-type calcium channels . At least seven isoforms of ω-agatoxin IIIA have been discovered, all with similar amino acid sequences and potencies for channel inhibition .

ω-Agatoxin TypeSequenceSwiss-Prot Accession
IIIASCIDIGGDCDGEKDDCQCCRRNGYCSCSLFGYLKSGCKCVVGTSAEFQGICRRKARQCYNSDPDKCESHNKPKRRP33034
IIIBSCIDFGGDCDGEKDDCQCCRSNGYCSCCYNLFGYLKSGCKCEVGTSAEFQGICRRKARQCYNSDPDKCVSYKPKRRP81744
IIICNCIDFGGDCDGEKDDCQCCXRNGYCSCCYNLFGYLKRGCKXEVGP81745
IIIDSCIKIGEDCDGDKDDCQCCRTNGYCSXYXLFGYLKSGP81746

How is recombinant Omega-agatoxin-Aa3a produced and what are its physical properties?

Recombinant Omega-agatoxin-Aa3a is produced using E. coli expression systems, which allows for the full-length protein (76 amino acids) to be expressed . The recombinant production overcomes limitations associated with natural extraction, which typically yields minimal amounts from spider venom.

The protein typically achieves a purity level greater than 85% as measured by SDS-PAGE . Its physical properties include:

  • Molecular weight: Approximately 8.5 kDa

  • Structure: Contains 12 cysteine residues forming six disulfide bonds

  • Expression region: Amino acids 1-76

  • Stability: Moderately stable when properly stored

For reconstitution, it is recommended to briefly centrifuge the vial before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, adding glycerol to a final concentration of 5-50% (typically 50%) and aliquoting for storage at -20°C/-80°C is recommended .

What is the mechanism of action of Type III ω-agatoxins on calcium channels?

Type III ω-agatoxins, including Omega-agatoxin-Aa3a, exhibit a complex mechanism of action on voltage-gated calcium channels. Unlike more selective toxins, Type III ω-agatoxins inhibit all known neuronal high-voltage-activated (HVA) calcium currents, including L-type, N-type, P/Q-type, and R-type channels, but with different affinities . They are particularly notable for being the only peptide ligands that completely block cardiac L-type calcium channels with high affinity, while they inhibit P/Q-type calcium currents by up to 40% .

The binding site location and mechanism of current blockade have been studied extensively. The evidence suggests that ω-agatoxin IIIA competitively inhibits the binding of ω-conotoxin MVIIC to N-type calcium channels . Since ω-conotoxin binding sites are located on the extracellular side of the channel, it is proposed that ω-agatoxin IIIA interacts at a similar position .

The blocking mechanism likely involves the toxin acting as a "leaky lid" near the outside of the pore, which reduces calcium current without completely blocking it . Being significantly larger than ω-conotoxin MVIIC, ω-agatoxin IIIA probably fits less tightly within the pore vestibule, explaining why it produces incomplete blocking of calcium ion flows while completely eliminating access of ω-conotoxin MVIIC . This suggests that ω-agatoxins IIIA inhibit calcium current either by direct occlusion of the channel pore or through binding to sites that are allosterically connected to the pore .

How do different neural tissues respond to ω-agatoxin exposure?

Research has revealed significant differences in the sensitivity of various neural tissues to ω-agatoxins. In a study examining the effects of ω-agatoxin IVA (a P/Q-type calcium channel blocker) on spontaneous action potential firing in neuronal networks, spinal cord networks demonstrated substantially higher sensitivity to the toxin compared to frontal cortex networks .

The differential response between these tissues is quantifiable:

  • Spinal cord networks showed statistically significant effects at concentrations as low as 10 nM

  • Frontal cortex networks required higher concentrations of approximately 50 nM to produce observable effects

Additionally, the effects on frontal cortex networks were more complex, exhibiting unit-specific responses that manifested as either increases or decreases in action potential firing rates . These responses could be statistically separated into unique clusters, suggesting differential effects on distinct neuronal populations .

When the GABAA inhibitor bicuculline was administered, it isolated a single response to ω-agatoxin characterized by a reduction in network activity . This finding supports the hypothesis that the two clusters of responses detected with ω-agatoxin exposure represent differential effects on excitatory versus inhibitory neuronal populations .

These tissue-specific responses have important implications for experimental design when using ω-agatoxins as tools to study neural circuits and for potential therapeutic applications targeting specific regions of the nervous system.

What are the optimal storage conditions and stability parameters for recombinant ω-agatoxins?

The shelf life and stability of recombinant ω-agatoxins depend on multiple factors including storage state, buffer composition, storage temperature, and the intrinsic stability of the protein itself . Based on experimental data, the following guidelines have been established:

For long-term storage:

  • Liquid form: 6 months stability at -20°C/-80°C

  • Lyophilized form: 12 months stability at -20°C/-80°C

For working aliquots:

  • Store at 4°C for up to one week

  • Repeated freezing and thawing is not recommended as it significantly reduces protein stability and activity

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is typically recommended)

  • Aliquot for long-term storage at -20°C/-80°C

These parameters are critical for maintaining the structural integrity and functional activity of the toxin, particularly given the importance of the disulfide bonds to its tertiary structure and biological activity.

What structural features of ω-agatoxins determine their specificity for calcium channel subtypes?

The structural characteristics of ω-agatoxins play a crucial role in determining their specificity for different calcium channel subtypes. Two-dimensional 1H NMR spectroscopy has revealed important insights into the spatial arrangement of these toxins .

For Type IV ω-agatoxins:

  • The molecular scaffold is highly stabilized by disulfide bridges

  • ω-Agatoxin IVA contains a short triple-stranded antiparallel β-sheet and three β-turns

  • The first β-turn is present in the loop between the β-strand and N-terminal fragment

  • The second and third β-turns are located in the long external loop between the first and second β-strand

These structural elements contribute to the high specificity of Type IV ω-agatoxins for P/Q-type calcium channels.

In contrast, Type III ω-agatoxins like Omega-agatoxin-Aa3a have a different structural organization:

  • They contain 12 cysteine residues forming six internal disulfide bonds

  • Their larger size (approximately 8.5 kDa) compared to Type IV variants affects their binding characteristics

  • The specific arrangement of their disulfide bonds creates a tertiary structure that enables interaction with multiple types of calcium channels

The less tight fit of Type III ω-agatoxins within the pore vestibule of calcium channels explains their broader activity profile across multiple channel types compared to the more selective Type IV variants.

How can researchers optimize experimental protocols to study ω-agatoxin effects on neuronal networks?

Microelectrode arrays (MEAs) provide an important tool for examining the effects of ω-agatoxins on neuronal networks . When designing experiments to study these effects, researchers should consider the following methodological approaches:

  • Tissue selection: Different neural tissues show varying sensitivities to ω-agatoxins. Experiments should be designed with appropriate concentration ranges based on the tissue being studied (10 nM for spinal cord networks vs. 50 nM for frontal cortex networks) .

  • Control experiments: Include pharmacological controls to isolate specific neuronal population responses. For example, using GABAA inhibitors like bicuculline can help differentiate between effects on excitatory versus inhibitory neurons .

  • Data analysis: Implement statistical methods capable of identifying distinct clusters of responses. This is particularly important when studying complex tissues like frontal cortex, where unit-specific responses may be observed .

  • Experimental conditions: Maintain consistent recording conditions when monitoring spontaneous activity of neuronal networks to accurately detect changes in extracellular action potentials .

  • Concentration gradients: Utilize incremental concentration steps to establish dose-response relationships, which can provide insights into the potency and efficacy of different ω-agatoxin variants.

  • Combined approaches: Integrate electrophysiological recordings with calcium imaging techniques to correlate channel blockade with functional neuronal outputs.

These methodological considerations can significantly enhance the quality and reproducibility of research involving ω-agatoxins and their effects on neural function.

How do ω-agatoxins compare with other neurotoxins for studying calcium channel function?

ω-Agatoxins offer distinct advantages and limitations compared to other neurotoxins used to study calcium channel function:

Compared to ω-conotoxins:

  • ω-Agatoxins IIIA are larger peptides than ω-conotoxin MVIIC and likely fit less tightly within the pore vestibule of calcium channels

  • While ω-conotoxins like MVIIC completely block specific channel subtypes, Type III ω-agatoxins produce incomplete blocking of calcium ion flows

  • ω-Agatoxins IIIA can competitively inhibit the binding of ω-conotoxin MVIIC to N-type calcium channels, making them useful for studying binding site interactions

Compared to synthetic calcium channel blockers:

  • ω-Agatoxins offer greater specificity for certain channel subtypes, particularly P/Q-type channels

  • As peptide toxins, they interact with the extracellular domains of channels, whereas many synthetic blockers target intracellular sites

  • Their larger size and complex structure enable interactions with multiple sites on the channel protein

The major advantage of Type IV ω-agatoxins is their availability for neurophysiology studies, as they are the only type of ω-agatoxin successfully synthesized for research applications . This accessibility makes them particularly valuable tools for investigating calcium channel functions in various experimental systems.

What potential novel applications exist for ω-agatoxins beyond traditional calcium channel studies?

While ω-agatoxins are primarily known for their effects on calcium channels, emerging research suggests potential novel applications that extend beyond traditional calcium channel studies:

  • Antimicrobial applications: The discovery of spider venom peptides with antimicrobial properties, such as GK37 from Oxyopes forcipiformis, suggests potential similar properties might exist in other spider toxins . Though not directly demonstrated for ω-agatoxins, their structural similarities to other spider toxins warrants investigation into possible antimicrobial activities.

  • Biomarker development: The specific binding properties of ω-agatoxins could potentially be leveraged to develop biomarkers for calcium channel expression in different tissues or pathological states.

  • Drug delivery systems: Modified versions of ω-agatoxins could potentially serve as targeting moieties for drug delivery systems aimed at neurons or other cells expressing specific calcium channel subtypes.

  • Synergistic therapeutic approaches: Given the differential effects of ω-agatoxins on excitatory versus inhibitory neuronal populations , there may be potential for developing combined therapeutic approaches that target specific neural circuits in neurological disorders.

  • Structural templates: The unique structural features of ω-agatoxins, particularly their disulfide bond patterns and β-sheet arrangements , could serve as templates for designing novel peptide-based therapeutics with enhanced stability and target specificity.

Exploring these novel applications will require innovative experimental approaches that build upon our current understanding of ω-agatoxin structure-function relationships.

What are the main challenges in working with recombinant ω-agatoxins and how can they be addressed?

Researchers face several technical challenges when working with recombinant ω-agatoxins:

  • Stability issues:

    • Challenge: The shelf life of liquid ω-agatoxins is limited to approximately 6 months even at -20°C/-80°C

    • Solution: Use lyophilized forms when possible (12-month stability), and add glycerol (5-50%) to reconstituted solutions for improved stability

  • Reconstitution complications:

    • Challenge: Improper reconstitution can lead to protein aggregation or reduced activity

    • Solution: Follow specific reconstitution protocols, including brief centrifugation prior to opening the vial and reconstituting in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Structural integrity:

    • Challenge: Maintaining the proper disulfide bond formation critical for toxin activity

    • Solution: Avoid reducing agents in buffers and minimize exposure to extreme pH conditions or temperatures that could disrupt disulfide bonds

  • Experimental variability:

    • Challenge: Different neural tissues show varying sensitivities to ω-agatoxins

    • Solution: Establish tissue-specific concentration ranges and standardize experimental conditions based on the specific neural preparation being studied

  • Interpretation of complex responses:

    • Challenge: ω-Agatoxins can produce unit-specific responses that manifest as either increases or decreases in neural activity

    • Solution: Employ sophisticated statistical analyses capable of identifying distinct response clusters, and use pharmacological tools like GABAA inhibitors to isolate specific neuronal population responses

By addressing these challenges with appropriate methodological adaptations, researchers can maximize the utility of recombinant ω-agatoxins in their experimental work.

What emerging technologies could enhance our understanding of ω-agatoxin structure-function relationships?

Several cutting-edge technologies hold promise for advancing our understanding of ω-agatoxin structure-function relationships:

  • Cryo-electron microscopy: This technique could provide high-resolution structural information about ω-agatoxins bound to their target calcium channels, offering insights into the precise molecular interactions that determine specificity and efficacy.

  • Advanced NMR methodologies: Building upon the earlier NMR studies of ω-agatoxin IVB , newer NMR technologies could reveal dynamic aspects of toxin-channel interactions that are not captured by static structural analyses.

  • Molecular dynamics simulations: Computational approaches could model the conformational changes that occur during ω-agatoxin binding to different calcium channel subtypes, potentially explaining the broader specificity of Type III ω-agatoxins compared to Type IV variants.

  • CRISPR-based channel engineering: Genetic modification of calcium channels could help identify specific amino acid residues critical for ω-agatoxin binding and efficacy, complementing direct structural studies.

  • Single-molecule fluorescence techniques: These approaches could track the binding and unbinding kinetics of fluorescently labeled ω-agatoxins to calcium channels in real-time, providing insights into the temporal aspects of toxin action.

By integrating these technologies into ω-agatoxin research, scientists can develop a more comprehensive understanding of how these fascinating toxins interact with their targets at the molecular level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.