Recombinant Aggregatibacter actinomycetemcomitans UPF0070 protein 1057 (1057)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Aggregatibacter actinomycetemcomitans UPF0070 protein 1057 (1057) is a protein derived from the bacterium Aggregatibacter actinomycetemcomitans . A. actinomycetemcomitans is a gram-negative bacterium that is part of the normal oral flora but can also cause invasive infections .

Function and Characteristics of Aggregatibacter actinomycetemcomitans

Aggregatibacter actinomycetemcomitans has several virulence factors that contribute to its pathogenicity . One such factor is the cytolethal distending toxin (Cdt), a heterotrimeric AB2 toxin composed of CdtA, CdtB, and CdtC subunits . The Cdt complex binds to cell surfaces and delivers the active subunit, CdtB, into the cell, leading to cell cycle arrest and apoptosis . Another virulence factor is ApiA, a trimeric autotransporter outer membrane protein (Omp) involved in auto-aggregation, epithelial cell binding, and complement resistance .

Role of Cellugyrin in CdtB Internalization

Research indicates that the internalization of CdtB, the active subunit of the A. actinomycetemcomitans Cdt toxin, depends on cellugyrin, also known as synaptogyrin 2 . Cellugyrin is a tetraspanin membrane protein present in most cells and functions in intracellular transport . Studies have shown that Cdt binding to cholesterol-rich membrane microdomains leads to increased cellugyrin levels and translocation to these microdomains . Cells deficient in cellugyrin are unable to internalize CdtB and are resistant to its toxic effects .

ApiA and Serum Resistance

ApiA, an outer membrane protein of A. actinomycetemcomitans, plays a crucial role in serum resistance by interacting with human Factor H, which disrupts the complement cascade . Specific regions within ApiA are responsible for Factor H binding and complement resistance . Deletion of a region spanning amino acids 186–217 in ApiA abrogates complement resistance and Factor H binding, while a 13-amino-acid peptide promotes serum resistance .

Virulence Variation Among Serotypes

Different serotypes of A. actinomycetemcomitans exhibit variations in virulence . Serotype a isolates show less heterogeneity compared to serotype b or c isolates . Variations in adhesion to epithelial cells and cytotoxic effects have been observed among different serotypes .

Table Summarizing Key Proteins and Their Functions

ProteinFunction
Cdt (Cytolethal Distending Toxin)Heterotrimeric toxin that induces cell cycle arrest and apoptosis
CdtBActive subunit of Cdt, internalized via cellugyrin
Cellugyrin (Synaptogyrin 2)Tetraspanin membrane protein crucial for CdtB internalization
ApiA (Omp100)Outer membrane protein involved in auto-aggregation, epithelial cell binding, and complement resistance
Factor HHuman protein that interacts with ApiA, conferring serum resistance
Leukotoxin (LtxA)Protein toxin secreted by A. actinomycetemcomitans that helps the bacterium evade the host immune response during infection

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its incorporation.
Synonyms
1057; Ancillary SecYEG translocon subunit; Periplasmic chaperone YfgM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)
Target Names
1057
Target Protein Sequence
MAYTIEEEQELTAIKAWWNENYKFIIVCFVIAFGGVFGWNYWQSHQIQKMHKASAEYEQA LFNYQKDPKAQAEQFNQFIKNNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQSN DDILSSVSALRLASVQFQLGQLDPALESLKSVKEQAWNSAKNLLAGDIQLAKGDKETAKK SYQQAQENAGALEQQLIQVRLNNL
Uniprot No.

Target Background

Function
May mediate protein transfer from the SecYEG translocon to the periplasmic chaperone network via its periplasmic C-terminal region.
Protein Families
UPF0070 family
Subcellular Location
Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.

Q&A

FAQs for Researchers on Recombinant Aggregatibacter actinomycetemcomitans UPF0070 Protein 1057 (1057)

What expression systems are optimal for producing recombinant UPF0070 protein 1057, and how do they impact functional studies?

Recombinant UPF0070 protein 1057 is produced in baculovirus (insect cells) and yeast systems, as demonstrated by product variants CSB-BP524438AYK1 (baculovirus) and CSB-YP524438AYK1 (yeast) . Key considerations:

  • Baculovirus systems are preferred for eukaryotic post-translational modifications but require longer production times.

  • Yeast systems offer faster production but may lack specific modifications.

  • Purity (>85% via SDS-PAGE) and storage conditions (lyophilized vs. liquid) affect protein stability. Lyophilized forms have a 12-month shelf life at -80°C, while liquid forms last 6 months .

How should researchers handle storage and reconstitution to maintain protein integrity?

  • Reconstitution: Centrifuge vials before resuspending in sterile water (0.1–1.0 mg/mL). Adding 5–50% glycerol improves long-term stability .

  • Storage: Avoid repeated freeze-thaw cycles. Working aliquots stored at 4°C retain stability for ≤1 week .

  • Critical step: Verify post-reconstitution activity via SDS-PAGE or functional assays to confirm structural integrity.

What assays are recommended for initial functional characterization of UPF0070 protein 1057?

  • Purity validation: SDS-PAGE and Western blotting using species-specific antibodies .

  • Functional screening: Partner with virulence studies of A. actinomycetemcomitans outer membrane vesicles (OMVs), which deliver toxins like leukotoxin (LtxA) . UPF0070 may share interaction pathways with OMV-associated proteins involved in immune evasion or nutrient acquisition .

How can structural variations in UPF0070 protein 1057 impact its role in bacterial pathogenesis?

  • Comparative analysis: Use circular dichroism (CD) spectroscopy to assess secondary structures (e.g., α-helix content) under different reconstitution conditions, as done for recombinant LtxA .

  • Domain mapping: Identify regions critical for interactions with host cells or other bacterial proteins using truncation mutants (see ApiA studies ).

What experimental strategies resolve contradictions in UPF0070’s functional data across studies?

  • Case example: If cytotoxicity assays yield inconsistent results, validate whether protein acylation (a post-translational modification) is required for activity, as observed in LtxA .

  • Controls: Include non-acylated protein variants and compare bioactivity via neutrophil granule exocytosis assays .

How can UPF0070 protein 1057 be integrated into studies of A. actinomycetemcomitans immune evasion mechanisms?

  • Interaction studies: Screen for binding to host complement regulators (e.g., Factor H) using surface plasmon resonance (SPR), a method validated for ApiA .

  • OMV proteomics: Co-purify UPF0070 with OMVs using density gradient centrifugation and LC-MS/MS, as described in .

Table 1: Comparison of Recombinant UPF0070 Protein Production Systems

ParameterBaculovirus Yeast
Expression HostInsect cellsSaccharomyces cerevisiae
Post-Translational ModificationsEukaryotic glycosylationLimited modifications
Shelf Life (Lyophilized)12 months at -80°C12 months at -80°C
Typical Yield0.1–1.0 mg/mL0.1–1.0 mg/mL

Table 2: Key Virulence-Related Proteins in A. actinomycetemcomitans for Functional Cross-Reference

ProteinFunctionInteraction with UPF0070?Source
LtxALeukotoxicity, immune evasionPotential OMV association
ApiA (Omp100)Serum resistance, Factor H bindingPossible regulatory link
OMP29Epithelial cell invasionStructural homology?

Methodological Recommendations

  • For structural studies: Combine CD spectroscopy with cryo-EM to resolve UPF0070’s tertiary structure .

  • For functional assays: Use neutrophil granule exocytosis models to test immunomodulatory effects .

  • For data validation: Cross-reference with OMVs proteomics datasets (e.g., ProteomeXchange PXD002509 ).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.