Recombinant Agkistrodon contortrix contortrix Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant MT-CYB is expressed in E. coli systems, leveraging bacterial machinery for cost-effective yields. Protocols include:

  • Vector Design: Codon-optimized MT-CYB cDNA cloned into prokaryotic expression vectors .

  • Purification: Affinity chromatography using tags (e.g., GST, His-tag) followed by buffer exchange into Tris/glycerol solutions .

  • Stability: Storage at -20°C to -80°C with 50% glycerol to prevent aggregation; avoid repeated freeze-thaw cycles .

Functional Role in Mitochondrial Respiration

MT-CYB is essential for oxidative phosphorylation (OXPHOS) as part of complex III:

  • Electron Transfer: Facilitates electron shuttling from ubiquinol to cytochrome c, coupled with proton translocation across the mitochondrial membrane .

  • Pathogenic Mutations: Variants like M4T (methionine to threonine at position 4) disrupt complex III assembly, leading to dilated cardiomyopathy and reduced enzyme activity .

Disease Modeling

  • Cardiomyopathy: The M4T mutation in MT-CYB was linked to impaired complex III activity in cardiac tissue, correlating with histiocytoid cardiomyopathy in clinical studies .

  • Mitochondrial Myopathies: Yeast models expressing human MT-CYB mutations (e.g., G339E) show abolished complex III activity, mirroring human pathologies .

Biotechnological Use

  • Antibody Production: Recombinant MT-CYB serves as an immunogen for generating antibodies used in mitochondrial disease diagnostics .

Challenges and Future Directions

  • Heteroplasmy Effects: Variable mutation load across tissues complicates phenotype-genotype correlations .

  • Therapeutic Targets: Small-molecule modulators of complex III activity are under investigation for metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific format requirements. Please indicate your preferences when placing your order, and we will do our best to accommodate your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery information, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life of our products can vary depending on several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your order.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Agkistrodon contortrix contortrix (Southern copperhead)
Target Names
Target Protein Sequence
YINYKNMSHQHMLTLFNLLPVGSNISIWWNFGSMLLTCLMIQIATGFFLAIHYTANINLA FSSIIHISRDVPYGWIMQNTHAIGASLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLII LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTTLTTWLWGGYAINDPTLTRFFALH FILPFAIISMSSIHILLLHNEGSNNPLGTNSDID
Uniprot No.

Target Background

Function
Cytochrome b, a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), is a crucial part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Agkistrodon contortrix contortrix Cytochrome b and why is it important for research?

Agkistrodon contortrix contortrix (Southern copperhead) Cytochrome b (MT-CYB) is a mitochondrial protein that functions as part of Complex III in the electron transport chain. This protein is encoded by the mitochondrial genome and is highly conserved across species, making it valuable for phylogenetic studies. MT-CYB has become particularly important in snake evolutionary research, taxonomy validation, and population genetics. The recombinant form of this protein enables researchers to study its structure and function without the need to extract it directly from copperhead specimens, thereby reducing the reliance on animal sourcing and providing a standardized research material . The copperhead snake has an estimated haploid genome size of 1.33 Gbp, and MT-CYB represents an important component for understanding the species' biology and evolutionary history .

How does recombinant Agkistrodon contortrix contortrix Cytochrome b differ from native MT-CYB?

Recombinant Agkistrodon contortrix contortrix Cytochrome b typically contains additional elements that aren't present in the native protein, such as affinity tags (His-tag, Myc-tag) that facilitate purification and detection . These modifications can affect certain protein properties but are designed to minimize functional interference. The recombinant protein is produced in expression systems such as E. coli, yeast, baculovirus, or mammalian cells, whereas native MT-CYB is embedded in the inner mitochondrial membrane of copperhead snake cells . While recombinant proteins provide the advantage of controlled production and purification, they may exhibit differences in post-translational modifications, folding patterns, and activity levels compared to their native counterparts. Researchers should account for these potential differences when designing experiments, particularly when studying the protein's interaction with other mitochondrial components or membrane integration properties .

What expression systems are most effective for producing recombinant Agkistrodon contortrix contortrix Cytochrome b?

Multiple expression systems can be utilized for producing recombinant Agkistrodon contortrix contortrix Cytochrome b, each with specific advantages depending on research requirements. Common expression hosts include E. coli, yeast, baculovirus-infected insect cells, and mammalian cell lines . E. coli systems offer high protein yields and cost-effectiveness but may struggle with proper folding of membrane proteins like Cytochrome b. Yeast systems (such as Pichia pastoris) provide post-translational modifications and better membrane protein expression capabilities. Baculovirus-infected insect cells often yield proteins with folding patterns more similar to native forms, while mammalian expression systems offer the most sophisticated post-translational processing but at higher cost and lower yields . For functional studies of Cytochrome b, insect or mammalian systems may be preferable despite their complexity, as they better preserve the protein's native conformation and heme integration properties. Researchers typically aim for at least 85% purity in the final product, as determined by SDS-PAGE analysis .

What are the optimal purification strategies for recombinant Agkistrodon contortrix contortrix Cytochrome b?

Purification of recombinant Agkistrodon contortrix contortrix Cytochrome b requires specialized techniques due to its hydrophobic nature as a membrane protein. The most effective purification strategy begins with affinity chromatography utilizing the engineered His-tag or Myc-tag commonly incorporated into the recombinant construct . After initial capture on Ni-NTA or anti-Myc columns, researchers should implement size exclusion chromatography to separate aggregated from properly folded protein. For highest purity, ion exchange chromatography can be employed as a polishing step. Throughout the purification process, maintaining the protein in a stable buffer containing mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin is critical to prevent aggregation of this hydrophobic protein. The purification protocol should be validated by SDS-PAGE analysis, western blotting, and activity assays to confirm that a minimum purity of 85% has been achieved and that the protein retains its heme group and functional properties . Researchers have reported that purification under mildly reducing conditions helps preserve the native conformation of the cytochrome b protein while preventing non-specific disulfide bond formation.

How can I verify the functional integrity of purified recombinant Agkistrodon contortrix contortrix Cytochrome b?

Verifying the functional integrity of purified recombinant Agkistrodon contortrix contortrix Cytochrome b requires multiple complementary approaches. The most direct functional assessment involves spectrophotometric analysis to confirm proper heme incorporation, characterized by specific absorption peaks at approximately 414 nm (Soret band), 530 nm (α-band), and 560 nm (β-band) when in the reduced state. Researchers should also perform electron transfer assays using artificial electron donors and acceptors to verify the protein's redox activity. Circular dichroism spectroscopy provides valuable information about secondary structure integrity, which should be compared with predicted structural models of snake Cytochrome b. For applications in phylogenetic studies, sequence verification through mass spectrometry is essential to confirm the absence of mutations that might have been introduced during the cloning or expression process . Additionally, reconstitution experiments with other components of the respiratory chain can demonstrate the protein's ability to participate in complex formation and electron transport. These combined approaches ensure that the recombinant protein maintains both structural and functional characteristics similar to the native Cytochrome b from Agkistrodon contortrix contortrix.

What are the key considerations when designing primers for Agkistrodon contortrix contortrix Cytochrome b gene amplification?

When designing primers for Agkistrodon contortrix contortrix Cytochrome b gene amplification, researchers must balance specificity with amplification efficiency. The MT-CYB gene in copperhead snakes exhibits regions of high conservation among related snake species alongside variable regions that are species-specific. Optimal primer design should target conserved flanking regions while ensuring the amplification product contains discriminatory sequences. Based on genomic analyses of A. contortrix, primers should have a GC content close to the genome's average of 42.51% to ensure efficient annealing . To avoid amplifying nuclear pseudogenes (NUMTs), which are mitochondrial DNA segments integrated into the nuclear genome, researchers should verify primer specificity against the complete genomic dataset. According to the genomic sequencing data, researchers should be particularly cautious of the 246 potential amplifiable loci that occur in multiple locations in the A. contortrix genome, as these may represent transposable element regions . For heterologous expression, primers should include appropriate restriction sites compatible with the chosen expression vector, as well as considerations for maintaining the reading frame and codon optimization for the selected expression system. Nested PCR approaches may be necessary when working with degraded DNA samples from preserved specimens.

How can recombinant Agkistrodon contortrix contortrix Cytochrome b be used in phylogenetic and evolutionary studies?

Recombinant Agkistrodon contortrix contortrix Cytochrome b serves as a valuable reference standard in phylogenetic and evolutionary studies of snake species. When comparing MT-CYB sequences across different populations or closely related species, researchers can use the recombinant protein to validate sequence predictions and test antibody cross-reactivity. The copperhead snake genome has been sequenced to approximately 2% coverage, yielding about 26.8 Mbp of sequence data distributed across 128,773 reads . This genomic information provides context for cytochrome b studies and allows researchers to place MT-CYB variations within broader evolutionary patterns. For population genetics studies, the recombinant protein can be used alongside microsatellite markers, of which 14,612 loci have been identified in the copperhead genome . The combination of MT-CYB sequence analysis with microsatellite data offers a multi-faceted approach to understanding speciation events, phylogeographic patterns, and adaptive evolution in venomous snakes. This integrated approach has proven particularly valuable in resolving taxonomic uncertainties within the Agkistrodon genus and establishing divergence timelines between Eastern and Western populations of copperhead snakes across their range in the eastern United States.

What role does Agkistrodon contortrix contortrix Cytochrome b play in studying snake venom evolution?

Agkistrodon contortrix contortrix Cytochrome b, while not a venom component itself, provides crucial evolutionary context for understanding snake venom development. As a highly conserved mitochondrial gene, MT-CYB offers a reliable phylogenetic framework against which venom protein evolution can be mapped. This approach has revealed that venom components such as contortrostatin (a unique dimeric disintegrin) evolved more rapidly than conserved mitochondrial proteins like Cytochrome b . Comparative analyses using recombinant MT-CYB as a reference point have demonstrated that venom proteins in the Agkistrodon genus underwent significant adaptive evolution, particularly in domains related to prey immobilization and tissue penetration. The contortrostatin gene, part of a 2027 bp precursor with a 1449 bp open reading frame, shows evidence of accelerated evolution compared to the more stable MT-CYB gene . This differential evolutionary rate helps researchers identify selection pressures specific to venom function versus those affecting basic cellular metabolism. By combining MT-CYB data with analyses of venom proteins like ACTX-6 (a 98 kDa protein isolated from Agkistrodon acutus with anticancer properties), researchers can reconstruct the evolutionary history of therapeutic compounds found in snake venoms .

What interactions between recombinant Agkistrodon contortrix contortrix Cytochrome b and other mitochondrial proteins should be considered in experimental design?

When designing experiments involving recombinant Agkistrodon contortrix contortrix Cytochrome b, researchers must account for its natural interactions with other mitochondrial proteins within Complex III (cytochrome bc1 complex). In its native environment, cytochrome b interacts with the iron-sulfur protein, cytochrome c1, and several other subunits to facilitate electron transfer between ubiquinol and cytochrome c. These interactions are critical to the protein's function and should be considered when interpreting experimental results. If studying the protein's role in electron transport, researchers should consider reconstitution experiments with other components of Complex III, either from the same species or from well-characterized model organisms. The presence of affinity tags in the recombinant protein may interfere with these interactions, so control experiments with tag-cleaved protein are advisable . Additionally, proper incorporation of the heme groups (typically heme bH and heme bL in cytochrome b) is essential for functional studies and may require specific expression conditions or reconstitution steps post-purification. Researchers studying the evolution of respiratory complexes should also consider the co-evolution patterns between MT-CYB and nuclear-encoded components of Complex III when designing comparative experiments across snake species.

How do mutations in Agkistrodon contortrix contortrix Cytochrome b affect electron transport chain function and what techniques can assess these impacts?

Mutations in Agkistrodon contortrix contortrix Cytochrome b can significantly alter electron transport chain efficiency through multiple mechanisms. Critical mutations may affect heme binding pockets, ubiquinone binding sites, or interaction surfaces with other Complex III components. To assess these impacts, researchers should employ a multi-faceted approach combining structural and functional analyses. Site-directed mutagenesis of recombinant MT-CYB allows for systematic investigation of specific residues' contributions to protein function. Electron paramagnetic resonance (EPR) spectroscopy can detect changes in the electronic properties of the heme groups resulting from mutations. Membrane potential measurements using potential-sensitive dyes in reconstituted systems provide functional readouts of electron transport efficiency. Advanced techniques such as protein-protein interaction assays (including surface plasmon resonance or microscale thermophoresis) can quantify how mutations affect binding kinetics with other complex components. For comprehensive analysis, researchers should consider reconstituting the mutant cytochrome b into proteoliposomes alongside other components of Complex III to measure electron transport rates under near-physiological conditions. These sophisticated approaches reveal how evolutionary adaptations in snake MT-CYB may have contributed to metabolic adjustments related to their ectothermic physiology and feeding patterns characterized by infrequent, large meals.

What challenges arise when comparing recombinant Agkistrodon contortrix contortrix Cytochrome b with other snake species' MT-CYB proteins?

Comparative analysis of recombinant Agkistrodon contortrix contortrix Cytochrome b with MT-CYB proteins from other snake species presents several methodological challenges that researchers must address. Sequence divergence between species may necessitate different expression and purification strategies, potentially introducing methodological artifacts when making direct comparisons. The heme incorporation efficiency varies significantly across expression systems and between species-specific sequences, requiring careful standardization of spectral properties when comparing functional characteristics. Researchers should employ multiple sequence alignment tools that account for the specific evolutionary patterns of mitochondrial genes in reptiles, which can differ from commonly used mammalian models. When examining MT-CYB in the context of adaptive evolution, it's crucial to distinguish between mutations driven by metabolic adaptation versus those reflecting phylogenetic relationships . Additionally, the presence of nuclear pseudogenes (NUMTs) can complicate genetic analyses if not properly accounted for in primer design and sequence verification. To overcome these challenges, researchers typically employ a combination of recombinant protein studies with comprehensive phylogenetic analyses, often incorporating additional mitochondrial and nuclear markers for context. This integrated approach has successfully resolved taxonomic uncertainties within the Viperidae family and clarified evolutionary relationships between Agkistrodon species across their geographical distribution.

How can structural biology techniques be applied to study recombinant Agkistrodon contortrix contortrix Cytochrome b and what are the technical limitations?

Structural biology techniques offer powerful insights into recombinant Agkistrodon contortrix contortrix Cytochrome b but present significant technical challenges. X-ray crystallography, while providing high-resolution structural data, is notoriously difficult with membrane proteins like cytochrome b due to their hydrophobicity and tendency to aggregate during crystallization attempts. Researchers have found greater success using cryo-electron microscopy (cryo-EM), which allows visualization of the protein within membrane-mimetic environments such as nanodiscs or detergent micelles. Nuclear magnetic resonance (NMR) spectroscopy can provide valuable information about dynamic regions of the protein but is limited by the size of cytochrome b and its membrane-associated nature. For successful structural studies, researchers must optimize expression to produce isotopically labeled protein (for NMR) or highly pure, homogeneous samples (for crystallography and cryo-EM). The incorporation of affinity tags must be carefully designed to minimize interference with structure while facilitating purification . Computational approaches, including homology modeling and molecular dynamics simulations, can complement experimental methods by predicting structural features based on the known structures of cytochrome b from other species. These computational models should be validated against biochemical data such as chemical cross-linking coupled with mass spectrometry, which can provide distance constraints between specific residues. Despite these challenges, structural studies of snake cytochrome b promise valuable insights into the molecular basis of its function in ectothermic vertebrates.

How does research on Agkistrodon contortrix contortrix Cytochrome b relate to therapeutic applications of snake venom components?

Research on Agkistrodon contortrix contortrix Cytochrome b provides important phylogenetic context for understanding the evolution and diversification of therapeutic venom components from the same species. While MT-CYB itself is not a therapeutic target, its study has facilitated the characterization of venom proteins with significant medical potential, such as contortrostatin. Contortrostatin, a unique dimeric disintegrin isolated from the venom of Agkistrodon contortrix contortrix, has demonstrated anti-cancer properties through its antagonism of integrins αIIbβ3, α5β1, αvβ3, and αvβ5 . These interactions inhibit platelet aggregation and disrupt cancer cell adhesion and invasion processes. The evolutionary relationship between conserved genes like MT-CYB and rapidly evolving venom components has helped researchers identify novel bioactive compounds with therapeutic potential. Similar approaches have led to the characterization of other Agkistrodon-derived compounds with anticancer activity, such as ACTX-6 and ACTX-8, which induce cancer cell apoptosis through mechanisms involving reactive oxygen species and the translocation of pro-apoptotic proteins . The success in cloning and expressing recombinant contortrostatin demonstrates the value of molecular techniques developed through basic research on proteins like MT-CYB, as these methods can be applied to produce therapeutic venom components in sufficient quantities for functional studies and potential clinical applications .

What genomic resources are available for studying Agkistrodon contortrix contortrix Cytochrome b and related proteins?

Genomic resources for studying Agkistrodon contortrix contortrix Cytochrome b and related proteins have expanded significantly in recent years. The 454 Genome Sequencer FLX platform has been used to sequence approximately 26.8 Mbp of the copperhead genome, representing about 2% of its estimated 1.33 Gbp haploid genome . This sequencing effort generated 128,773 reads with an average length of 215 bp and a GC content of 42.51%. The dataset includes 14,612 microsatellite loci identified in 11.3% of all reads, providing valuable markers for population genetic studies that complement MT-CYB analyses . Specific reads containing MT-CYB sequences have been deposited in GenBank, along with 4,564 potentially amplifiable loci that have flanking sequences suitable for PCR primer design. Researchers should note that 246 of these loci may represent microsatellites within transposable element regions, which could complicate certain genetic analyses . Beyond these specific resources, comparative genomic approaches can leverage data from related snake species with more complete genome assemblies. Transcriptomic data from venom gland studies provides additional context for understanding the relationship between MT-CYB evolution and venom protein diversification. These combined resources enable integrated studies of mitochondrial function, population genetics, and the evolution of therapeutically relevant venom components in Agkistrodon contortrix contortrix.

What emerging technologies might advance research on recombinant Agkistrodon contortrix contortrix Cytochrome b in the next decade?

Several emerging technologies promise to revolutionize research on recombinant Agkistrodon contortrix contortrix Cytochrome b in the coming decade. Long-read sequencing technologies such as Pacific Biosciences and Oxford Nanopore are enabling more complete genome assemblies of snake species, providing better context for understanding MT-CYB's genomic environment and potential nuclear pseudogenes. Advanced protein expression systems, including cell-free systems optimized for membrane proteins, may overcome current challenges in producing properly folded recombinant snake cytochrome b with correct heme incorporation. Single-molecule functional techniques will allow researchers to observe electron transport events in individual cytochrome b molecules, revealing functional heterogeneity masked in bulk measurements. CRISPR-Cas9 systems adapted for mitochondrial genome editing could potentially enable in vivo studies of MT-CYB mutations in model organisms, bridging the gap between recombinant protein studies and physiological impacts. AlphaFold and similar AI-driven protein structure prediction tools will improve structural models of snake cytochrome b, facilitating targeted functional studies without requiring crystallization. Advances in cryo-electron tomography may enable visualization of cytochrome b within intact mitochondrial membranes, providing unprecedented insights into its native functional environment. Finally, microfluidic systems for high-throughput functional assays will accelerate comparative studies across snake species, mapping structure-function relationships with evolutionary patterns. These technological developments will enable researchers to address fundamental questions about the adaptation of mitochondrial function in snakes and potentially uncover new applications related to the unique metabolic adaptations of these fascinating reptiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.