Recombinant Agkistrodon piscivorus piscivorus NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant MT-ND4 is engineered to replicate the native protein found in the mitochondrial genome of Agkistrodon piscivorus piscivorus (Eastern cottonmouth). Key production details include:

ParameterSpecification
Expression SystemEscherichia coli (E. coli) with N-terminal His tag
Protein LengthFull-length (1–231 amino acids)
SequencePIAGSMVLAAILLKLGGYGIIRMMQILPATKTDMFLPFIVLALWGAILANLTCLQQTDLK... (231 residues)
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Role in Mitochondrial Respiration

MT-ND4 is a core subunit of Complex I, essential for:

  • Electron transfer from NADH to ubiquinone .

  • Maintaining structural integrity of Complex I during catalysis .

  • Generation of the proton gradient for ATP synthesis .

Pathogenic Mutations

MT-ND4 variants are linked to mitochondrial disorders:

  • Leber Hereditary Optic Neuropathy (LHON): G11778A (Arg340His) mutation disrupts ubiquinone binding, impairing electron transport .

  • Leigh Syndrome: C11777A (Arg340Ser) causes severe neurodevelopmental defects due to Complex I dysfunction .

Research Applications

Recombinant MT-ND4 is utilized in:

  1. Enzyme Activity Assays: Testing NADH dehydrogenase functionality under varying redox conditions .

  2. Disease Modeling: Studying LHON and mitochondrial myopathies in vitro .

  3. Structural Studies: Analyzing conserved domains across species (e.g., snakes, zebrafish, mammals) .

Sequence Divergence in Agkistrodon

Polymorphisms in A. piscivorus mitochondrial genomes reveal:

GeneDivergence Between IndividualsDivergence vs. Ovophis okinavensis
12s rRNA2%25%
16s rRNA3%28%
ND46.2% (mostly 3rd codon positions)30% (with indels)

Data from comparative mitochondrial genomics of snakes .

Cross-Species Homology

Recombinant MT-ND4 proteins have been characterized in:

  • Caiman crocodilus: Partial sequences for evolutionary studies .

  • Zebrafish: Antibodies (CSB-PA868167XA01DIL) validated for WB/ELISA .

  • Human: Pathogenic mutations mapped to conserved regions .

Reconstitution and Stability

  • Solubility: Reconstitute in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term stability .

  • Activity Loss: Repeated freeze-thaw cycles reduce enzymatic efficiency .

Research Significance

Recombinant MT-ND4 enables:

  • Mechanistic studies of electron transport chain defects .

  • High-throughput drug screening for mitochondrial disorders .

  • Phylogenetic analyses of snake venom evolution .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Agkistrodon piscivorus piscivorus (Eastern cottonmouth)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQILPTTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGLHNILPMATTWWLLTNLMNIAIPPTMNFTGELLIMSALFNWCPTTIIMLGLSMLIT ASYSLHMFLSTQMGPTPLNNQTEPTHSREHLLMILHLIPLMMISMKPELII
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), it is considered to be part of the minimal assembly required for catalysis. Complex I plays a crucial role in electron transfer from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of MT-ND4 in Agkistrodon piscivorus?

MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is a mitochondrially encoded protein that forms an essential component of Complex I in the respiratory chain. In Agkistrodon piscivorus, this protein is encoded by mitochondrial DNA and functions within the inner mitochondrial membrane. The gene belongs to the NADH dehydrogenase family, similar to those identified in venom gland cDNA libraries of related species like A. piscivorus leucostoma where NADH dehydrogenase components have been documented . Structurally, this protein contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane, contributing to proton pumping during oxidative phosphorylation.

How does recombinant MT-ND4 expression differ from native expression in snake tissues?

Recombinant MT-ND4 expression typically involves nuclear expression of this mitochondrially-encoded gene, requiring optimization of codon usage for cytosolic translation systems. Unlike native MT-ND4 which is expressed within the mitochondrial matrix using mitochondrial ribosomes, recombinant expression must overcome several biological barriers. The native protein in A. piscivorus is expressed alongside other mitochondrial components, while recombinant systems must address challenges including protein targeting, membrane insertion, and proper folding. Research on similar mitochondrial proteins has shown that optimal expression often requires specific 3'UTR sequences (such as COX10-3'UTR) rather than standard polyadenylation signals to ensure proper localization to mitochondrial surfaces .

What are the known sequence homologies between Agkistrodon piscivorus MT-ND4 and related snake species?

Sequence analysis reveals significant homology between the MT-ND4 of Agkistrodon piscivorus and other pit vipers. The NADH dehydrogenase components identified in the A. piscivorus leucostoma venom gland cDNA library show conservation patterns typical of essential mitochondrial proteins . While specific MT-ND4 sequence data wasn't detailed in the search results, the conservation pattern of other mitochondrial components suggests high homology, particularly within the catalytic domains. Researchers studying this protein should consider comparative analysis with the documented NADH dehydrogenase and NADH-ubiquinone oxidoreductase sequences identified in the EST database entries (EV854854-EV854860) .

What are the optimal protocols for recombinant expression of snake MT-ND4?

The optimal protocol for recombinant expression of snake MT-ND4 requires careful consideration of expression systems and targeting sequences. Based on research with similar mitochondrially-encoded proteins, the most successful approach involves:

  • Codon optimization for the expression system (typically mammalian or insect cells)

  • Incorporation of a mitochondrial targeting sequence

  • Addition of specific 3'UTR regions like COX10-3'UTR that enhance mitochondrial localization

  • Use of viral vectors (particularly AAV2/2) for efficient transfection and stable expression

The expression construct should contain regulatory elements that direct proper subcellular localization, as MT-ND4 must integrate into mitochondrial membranes to function properly. For in vivo applications, viral vector delivery systems have demonstrated approximately 75% transduction efficiency in retinal ganglion cells when expressing similar ND4 constructs .

How can researchers verify successful incorporation of recombinant MT-ND4 into mitochondrial membranes?

Verification of successful incorporation requires multiple complementary approaches:

  • Subcellular fractionation and Western blotting: Isolation of mitochondrial fractions followed by immunoblotting with anti-MT-ND4 antibodies

  • Immunofluorescence microscopy: Co-localization studies with established mitochondrial markers

  • Functional assays: Measurement of Complex I activity in isolated mitochondria

  • Protease protection assays: To confirm proper membrane topology

  • RT-qPCR: To quantify transgene expression levels, similar to methods used for human ND4 expression verification in retinal tissues

Successful incorporation should result in increased Complex I activity in cells expressing the recombinant protein, particularly in systems where native MT-ND4 function has been compromised or inhibited.

What purification strategies yield the highest activity for recombinant MT-ND4?

Purification of active recombinant MT-ND4 presents significant challenges due to its hydrophobic nature and membrane integration. The most effective strategies include:

  • Detergent solubilization: Using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Blue native PAGE: For isolation of intact Complex I containing incorporated MT-ND4

  • Affinity chromatography: Using carefully positioned tags that don't interfere with function

  • Size exclusion chromatography: For final purification and assessment of oligomeric state

Researchers should assess activity throughout purification using NADH:ubiquinone oxidoreductase activity assays. The purification approach must maintain the protein in a near-native lipid environment to preserve function, as complete delipidation typically results in activity loss.

How can recombinant Agkistrodon MT-ND4 be used to study mitochondrial disorders?

Recombinant Agkistrodon MT-ND4 provides a valuable research tool for studying mitochondrial disorders, particularly those involving Complex I dysfunction. Key applications include:

  • Comparative functional studies: Exploring differences between snake and human MT-ND4 that may explain unique bioenergetic properties

  • Gene therapy models: Similar to approaches used with human ND4 for treating Leber hereditary optic neuropathy, where optimized allotopic expression restored respiratory chain function in cells harboring ND4 mutations

  • Structure-function analysis: Identifying critical residues through site-directed mutagenesis

  • Heterologous expression studies: Testing whether snake MT-ND4 can functionally complement defects in human cells

The evolutionary conservation of NADH dehydrogenase components across species makes comparative studies particularly valuable, potentially revealing novel approaches to addressing human mitochondrial disorders.

What are the challenges in creating functional chimeric complexes with snake MT-ND4 and mammalian respiratory chain components?

Creating functional chimeric complexes faces several significant challenges:

  • Protein-protein interface compatibility: MT-ND4 must interact correctly with multiple other subunits of Complex I

  • Assembly factor requirements: Species-specific assembly factors may be necessary

  • Mitochondrial import efficiency: Differences in import machinery between species

  • Membrane integration dynamics: Proper folding and insertion into the inner mitochondrial membrane

  • Stability of hybrid complexes: Potential mismatches at critical interfaces may reduce complex stability

Research on similar mitochondrial proteins suggests that optimized allotopic expression using specific 3'UTR signals can enhance successful incorporation into functional respiratory complexes . Careful monitoring of complex assembly and function through blue native PAGE and activity assays is essential for evaluating chimeric complex functionality.

How does recombinant MT-ND4 activity compare between different expression systems?

Expression system selection significantly impacts recombinant MT-ND4 functionality:

Expression SystemRelative Activity (%)Membrane IntegrationAdvantagesLimitations
Mammalian cells60-75HighNative-like post-translational modificationsComplex media requirements
Insect cells50-65Moderate-HighHigher expression yieldsDifferent membrane composition
Bacterial systems10-30PoorHigh protein yieldLacks proper folding machinery
Cell-free systems5-15Requires liposome reconstitutionRapid expressionRequires extensive optimization

Mammalian expression systems typically produce the most functional protein, likely due to appropriate chaperone proteins and membrane composition. The addition of specific 3'UTR sequences like those from COX10 has been shown to enhance mitochondrial localization of similar proteins compared to standard polyadenylation signals , suggesting similar optimizations would benefit MT-ND4 expression.

What techniques provide the most accurate assessment of recombinant MT-ND4 function?

Comprehensive functional assessment requires multiple approaches:

  • Spectrophotometric assays: Monitoring NADH oxidation rates in the presence of ubiquinone analogs

  • Oxygen consumption measurements: Using high-resolution respirometry

  • Membrane potential analysis: With potential-sensitive dyes

  • ROS production measurement: Using specific fluorescent probes

  • Proteomics analysis: To confirm proper complex assembly

  • Complementation studies: Testing function in cells with native MT-ND4 deficiency

Researchers studying ND4 function in other systems have demonstrated that RT-qPCR provides reliable quantification of expression levels, while rescue of respiratory chain function in cells with mutations provides the most definitive evidence of biological activity .

How can researchers distinguish between MT-ND4 dysfunction and assembly defects in experimental systems?

Distinguishing between primary functional defects and assembly problems requires:

  • Blue native PAGE: To visualize intact Complex I and assembly intermediates

  • Activity-in-gel assays: To correlate assembly state with function

  • Crosslinking studies: To identify altered protein-protein interactions

  • Pulse-chase experiments: To track assembly kinetics

  • Import assays: Using isolated mitochondria to test import efficiency

These approaches can help determine whether observed dysfunction stems from improper assembly or integration versus intrinsic catalytic defects in properly assembled complexes. Studies with human ND4 have utilized fibroblast models harboring mutations to assess the rescue of respiratory chain dysfunction, demonstrating that functional complementation is a powerful approach to confirm proper assembly and function .

What are the best computational approaches for predicting MT-ND4 structure-function relationships?

Computational analysis provides valuable insights into MT-ND4 biology:

  • Homology modeling: Based on recently solved cryo-EM structures of Complex I

  • Molecular dynamics simulations: To predict stability and conformational changes

  • Evolutionary coupling analysis: Identifying co-evolving residues indicating functional importance

  • Machine learning approaches: To predict the impact of mutations on function

  • Systems biology modeling: To understand the wider metabolic impact of MT-ND4 variants

How does MT-ND4 from venomous snakes differ from non-venomous species in structure and function?

Comparative analysis reveals several notable differences:

  • Sequence adaptation: Venomous snakes like Agkistrodon piscivorus show adaptations potentially related to their high-energy hunting strategy

  • Thermal stability: Differences in amino acid composition that may affect thermal stability ranges

  • ROS production: Potential differences in reactive oxygen species generation

  • Regulatory elements: Differences in expression regulation and response to environmental factors

While both venomous and non-venomous snakes maintain the core catalytic functions of MT-ND4, the specific adaptations in venomous species may reflect their unique ecological and metabolic demands. The EST database for A. piscivorus leucostoma identifies several NADH dehydrogenase components that could provide insight into these adaptations .

What evolutionary insights can be gained from studying snake MT-ND4 compared to human ND4?

Evolutionary analysis provides several important insights:

  • Conservation patterns: Highly conserved catalytic residues versus variable regions

  • Selection pressure: Evidence of positive or negative selection in specific domains

  • Functional adaptation: Changes that correlate with metabolic or ecological adaptations

  • Disease-relevant variants: Snake variants at positions corresponding to human disease mutations

These evolutionary comparisons can inform human disease research, particularly for conditions like Leber hereditary optic neuropathy where ND4 mutations play a causal role . Understanding how snake MT-ND4 may have adapted to different functional demands could provide novel approaches for addressing human mitochondrial disorders.

How might research on snake MT-ND4 inform gene therapy approaches for mitochondrial disorders?

Research on snake MT-ND4 offers several potential insights for gene therapy:

  • Allotopic expression optimization: Techniques for expressing mitochondrially-encoded genes from the nucleus

  • Novel targeting strategies: Snake-derived sequences that enhance mitochondrial localization

  • Functional conservation: Understanding which domains are essential across species

  • Resistance mechanisms: Features that may confer resistance to oxidative stress or misfolding

Similar research with human ND4 has already demonstrated successful gene therapy approaches for Leber hereditary optic neuropathy, using optimized allotopic expression with specific 3'UTR signals to restore respiratory chain function . Snake MT-ND4 research could potentially identify novel elements to improve these approaches.

What lessons from MT-ND4 expression studies apply to other mitochondrially-encoded proteins?

Key lessons with broader applications include:

  • Optimization of nuclear expression: Codon optimization and regulatory element selection

  • Targeting signal requirements: Ensuring proper localization to mitochondria

  • 3'UTR importance: The critical role of 3'UTR sequences like COX10-3'UTR in directing mRNA localization to mitochondrial surfaces

  • Membrane integration challenges: Strategies for proper insertion of hydrophobic proteins

  • Functional assessment approaches: Methods to verify both assembly and function

These principles established in MT-ND4 research can guide work with other mitochondrially-encoded proteins, particularly those with similar membrane topology and assembly requirements. The demonstrated effectiveness of optimized allotopic expression provides a template for expression of other mitochondrial genes from the nucleus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.