Recombinant Agrobacterium radiobacter Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Apolipoprotein N-acyltransferase (Lnt) catalyzes the final step in lipoprotein biosynthesis: the transfer of an acyl group from phospholipids to the α-amino group of apolipoproteins, forming mature triacylated lipoproteins . In Agrobacterium radiobacter, this enzyme (UniProt ID: B9J8B4) shares functional and structural homology with Lnt from Escherichia coli and other Gram-negative bacteria . Recombinant versions are expressed in E. coli systems for research applications .

Enzymatic Mechanism

Lnt operates via a ping-pong mechanism:

  1. Acyl transfer: Phospholipid (e.g., phosphatidylethanolamine) donates an acyl group to C387, forming a thioester intermediate .

  2. N-acylation: The α-amino group of apolipoproteins attacks the thioester, transferring the acyl chain to the substrate .

Kinetic studies reveal:

  • Specificity for phospholipids with ethanolamine headgroups (kcat/Km=1.2×104M1s1k_{cat}/K_m = 1.2 \times 10^4 \, \text{M}^{-1}\text{s}^{-1}) .

  • Slow acyl-enzyme formation (kcat=0.03s1k_{cat} = 0.03 \, \text{s}^{-1}) but rapid N-acylation (kcat=12s1k_{cat} = 12 \, \text{s}^{-1}) .

Functional Insights from Mutational Studies

  • E267A/E343A: Disrupts thio-acylation of C387, abolishing activity .

  • K335A: Partially destabilizes tetrahedral intermediates, reducing efficiency .

  • W237A/Y388A: Blocks apolipoprotein binding without affecting acyl-enzyme formation .

Temperature-sensitive mutants (e.g., G232D) exhibit structural flexibility defects .

Biotechnological Applications

  • Lipoprotein Engineering: Used to study lipidated virulence factors in pathogens .

  • Structural Biology: Crystal structures (e.g., PDB 5LNT) aid drug design targeting bacterial membranes .

  • Enzyme Kinetics: In vitro assays with synthetic lipopeptides (e.g., FSL-1) quantify acyltransferase activity .

Genomic and Taxonomic Context

  • Agrobacterium radiobacter Lnt shares 78% sequence identity with E. coli Lnt .

  • Genomic reclassification proposes merging A. radiobacter and A. tumefaciens into subspecies due to high average nucleotide identity (ANI >99%) .

Research Challenges

  • Contamination Risks: Earlier A. radiobacter genome assemblies contained cross-strain contaminants, complicating comparative studies .

  • Instability: Recombinant Lnt requires glycerol stabilization and strict storage protocols (-80°C) to prevent aggregation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lnt; Arad_0660; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-533
Protein Length
full length protein
Species
Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
Target Names
lnt
Target Protein Sequence
MERLSGKVILVWGFKRALLAILAGAIGVLALPPFGFFAAMFVSFTLLVWLLDGAAAGPDS GFLGRLWPAFTTGWLFGFGYFVAGLWWLGHALLIDADQFAWALPLAILGLPAFLAIFYGV AAVLARLLWSDGMGRIAALAFGFGLLEWLRSFLFTGFPWNAIGYGAMPIPLMMQSAHVIG VLGVTVLAVFVFAAPALLGTRQGRVPGIGLAVLIAAAHFAYGYYALNLPALPPAAGKAAP VVRIVQPAIDQEAKMDTAADRNAIFDKHLSLSVQPPVNGGKRPDIIVWPETAIPFILTDN QDALTRIADQLDDDQILITGAVRVEDMGPGVEPRYYNSVYVIDGRGQIIGASDKTHLVPF GEYVPFENILGYLGIENVVELPGGFSAAASRQLLTLPDGIKLYPLICYEIIFPNEMTPEI RQADAILNVTNDAWFGDTPGPYQHFLQARVRAVEQGLPLIRSANTGVSAYVDAHGRLISG IDFNEQGFVDSTLSGATVSRIDDSVRKTYFWLIIGIVGMIAVISRMGFISRVN
Uniprot No.

Target Background

Function

This recombinant Agrobacterium radiobacter apolipoprotein N-acyltransferase (Lnt) catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.

Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (Lnt) and what is its primary function?

Apolipoprotein N-acyltransferase (Lnt) is an integral membrane enzyme that catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoproteins, representing the final step in bacterial lipoprotein maturation. This post-translational modification is critical for proper lipoprotein sorting and localization to the outer membrane in Gram-negative bacteria .

The reaction involves the transfer of an acyl chain from a phospholipid donor (typically phosphatidylethanolamine in vivo) to the alpha-amino group of the N-terminal cysteine of the apolipoprotein, forming the mature triacylated lipoprotein .

What are the structural characteristics of Agrobacterium radiobacter Lnt?

Agrobacterium radiobacter Lnt (strain K84 / ATCC BAA-868) has the following characteristics:

  • Length: 533 amino acids

  • Molecular weight: 57.5 kDa

  • Family: CN hydrolase family, Apolipoprotein N-acyltransferase subfamily

  • Membrane topology: Integral membrane protein with multiple transmembrane domains

The protein contains several key structural elements, including:

  • Transmembrane domains that anchor the protein in the bacterial membrane

  • A periplasmic nitrilase-like domain containing the catalytic residues

  • Flexible arms that are believed to facilitate substrate binding and product release

What is the proposed catalytic mechanism of Lnt?

Lnt operates through a ping-pong type mechanism involving two distinct steps:

  • First step: Formation of a thioester acyl-enzyme intermediate where the acyl chain from a phospholipid (typically phosphatidylethanolamine) is transferred to the catalytic cysteine (C387 in E. coli Lnt) forming a thioester linkage and releasing a lysophospholipid by-product.

  • Second step: Resolution of the thioester intermediate by the alpha-amino group of the N-terminal cysteine of the apolipoprotein substrate, resulting in the transfer of the acyl chain to form the mature triacylated lipoprotein .

Studies have shown that in vivo, the majority of Lnt molecules exist in the C387-acyl-enzyme intermediate form, suggesting this is a stable state in the enzyme's catalytic cycle .

What expression systems are recommended for producing recombinant Agrobacterium radiobacter Lnt?

While the search results don't detail specific expression systems for A. radiobacter Lnt, commercial suppliers indicate successful heterologous expression is possible. Based on research with Lnt from other bacterial species, the following approaches are recommended:

  • Expression in E. coli membrane fractions, as Lnt is an integral membrane protein

  • Use of specialized E. coli strains optimized for membrane protein expression

  • Addition of solubility-enhancing tags or fusion partners

  • Controlled expression using inducible promoters to prevent toxicity

For research-scale production, expression services are available starting at $99 + $0.30/amino acid, with protein delivery possible in as little as two weeks .

What methods can be used to assess Lnt enzymatic activity in vitro?

For analyzing Lnt activity, researchers have developed several in vitro assays:

  • Thioester acyl-enzyme intermediate formation assay:

    • Using maleimide-PEG (malPEG) alkylation to detect the free thiol of the catalytic cysteine

    • Treatment with hydroxylamine (HA) to cleave the thioester bond prior to malPEG treatment

    • Analysis by SDS-PAGE to detect mobility shifts indicating alkylation status

  • N-acyltransferase activity assay:

    • Mixed micelle assay using purified enzyme, a synthetic diacylglyceryl-modified lipopeptide substrate (e.g., FSL-1), and various phospholipid acyl donors

    • Incorporation of radiolabeled fatty acids (e.g., [³H]palmitate) to track acyl transfer

    • Mass spectrometry analysis to confirm product formation

These assays allow researchers to separately analyze both steps of the ping-pong reaction mechanism.

How can I identify and characterize essential residues in Lnt?

Identification of essential residues in Lnt has been accomplished through:

  • Sequence conservation analysis across bacterial species

  • Site-directed mutagenesis of conserved residues

  • In vivo complementation assays to assess functionality

  • Biochemical assays to determine which step of the catalytic mechanism is affected

For example, researchers identified the following critical residues in E. coli Lnt:

  • Catalytic triad: E267-K335-C387

  • Substrate binding and active site: W237, Y388, E389, E343

  • Residues affecting the thioester acyl-enzyme intermediate: E267, E343

The substitution analysis approach reveals which residues are:

  • Absolutely required for enzyme function

  • Temperature-dependent for function

  • Involved in specific steps of the catalytic mechanism

What structural information is available for Lnt, and how do conformational changes relate to its function?

Crystal structures of Lnt have revealed important insights into its mechanism:

Two distinct crystal forms have been reported:

  • A form with two molecules in the asymmetric unit:

    • One molecule showing the thioester acyl-intermediate

    • The other molecule suggesting a potential apolipoprotein docking mode

  • A form with one molecule in the asymmetric unit:

    • Representing an apparent apo-state

    • Notably lacking any bound molecules in the substrate entry portal

These structures suggest that movement of the essential W237 residue is triggered by substrate binding and likely helps direct and stabilize the interaction between Lnt and the incoming substrate apolipoprotein . The flexible arms facing away from the active site are believed to open and close upon binding and release of phospholipid and/or apolipoprotein substrates .

How do the crystal structures inform our understanding of Lnt substrate recognition?

The crystal structures of Lnt have provided valuable insights into how the enzyme recognizes and processes its substrates:

  • The enzyme contains a large open substrate entry portal that can accommodate various phospholipid substrates

  • Crystal packing observed in one of the structures suggests a potential mode of apolipoprotein docking to Lnt

  • The movement of essential residues like W237 appears to be critical for substrate interaction and stabilization

These structural insights help explain experimental findings regarding phospholipid specificity, showing that:

  • The N-acyltransferase activity is strongly affected by phospholipid headgroup and acyl chain composition

  • Contrary to earlier in vitro observations, the enzyme exhibits distinct preferences for certain phospholipid substrates

How conserved is Lnt across different bacterial species, and what does this tell us about its evolutionary importance?

  • Lnt proteins from various Proteobacteria are functional when expressed in E. coli

  • Lnt homologs from Actinomycetes lack function when expressed in E. coli

  • The essential residues identified in E. coli Lnt (E267-K335-C387 catalytic triad and W237, Y388, E389, E343) are conserved in functional Lnt proteins from other Proteobacteria

This conservation pattern suggests that while the core catalytic mechanism is preserved, there may be species-specific adaptations in substrate recognition or membrane integration.

What is known about Lnt from Agrobacterium radiobacter compared to other bacterial species?

The Lnt from Agrobacterium radiobacter (strain K84 / ATCC BAA-868) shares the core characteristics of other bacterial Lnt enzymes but has some distinct features:

Similarities:

  • Belongs to the CN hydrolase family, Apolipoprotein N-acyltransferase subfamily

  • Catalyzes the same N-acylation reaction in lipoprotein biosynthesis

  • Contains the conserved catalytic residues identified in E. coli Lnt

Unique features:

  • Has 533 amino acids (compared to different lengths in other species)

  • Shows species-specific amino acid sequence variations while maintaining the core functional domains

  • Is encoded in a bacterial strain (K84) that has been thoroughly evaluated for safety and is used as a biocontrol agent

This comparison demonstrates how a conserved enzyme can adapt to the specific cellular environment and requirements of different bacterial species while maintaining its fundamental catalytic function.

How does Lnt achieve specificity for its phospholipid substrates?

Research has demonstrated that Lnt exhibits significant preferences for both phospholipid headgroups and acyl chain compositions, contrary to earlier in vitro observations:

  • Phospholipid headgroup specificity:

    • Phosphatidylethanolamine is the preferred substrate in vivo in E. coli

    • The enzyme can utilize other phospholipids with varying efficiencies

  • Acyl chain preferences:

    • The N-acyltransferase activity shows selectivity for certain acyl chain lengths and saturations

    • This specificity is likely mediated through the hydrophobic pocket that constitutes the active site

The structural studies suggest that residues Y388 and E389, which are part of this hydrophobic pocket, play crucial roles in determining substrate specificity by directly interacting with the acyl chains of the phospholipid substrates .

What is the role of the thioester acyl-enzyme intermediate in Lnt function?

The thioester acyl-enzyme intermediate is a central feature of Lnt's catalytic mechanism:

  • Formation: The thioester bond forms between the catalytic cysteine (C387 in E. coli) and an acyl chain from a phospholipid donor

  • Stability: This intermediate is remarkably stable, with the majority of Lnt molecules existing in this acylated state in vivo

  • Resolution: The intermediate is resolved by nucleophilic attack from the alpha-amino group of the N-terminal cysteine of the apolipoprotein substrate

The stability of this intermediate likely serves an important biological function, ensuring that the enzyme is primed for rapid response when apolipoprotein substrates become available.

How do specific mutations affect Lnt activity, and what do they reveal about the enzyme's mechanism?

Mutational studies have provided crucial insights into Lnt's structure-function relationships:

MutationEffect on Lnt FunctionMechanistic Implication
E267ALoss of functionCritical for thioester acyl-enzyme intermediate formation
K335APartial activityStabilizes tetrahedral intermediates in both reaction steps
C387AComplete loss of functionEliminates the nucleophile required for thioester formation
W237ALoss of functionRequired for apolipoprotein substrate binding
Y388ALoss of functionPart of hydrophobic pocket constituting the active site
E389ALoss of functionPart of hydrophobic pocket constituting the active site
E343ALoss of functionLocated on flexible arm, critical for substrate interaction

Temperature-dependent mutations have also been identified, which retain function at permissive temperatures but lose activity at restrictive temperatures. These mutations were not associated with protein stability issues, suggesting they affect specific aspects of catalysis or substrate interaction .

What approaches can be used to engineer Lnt variants with altered substrate specificity or enhanced activity?

Based on the structural and functional insights, several strategies for engineering Lnt variants can be considered:

  • Targeted modification of the hydrophobic pocket (including residues Y388 and E389) to alter phospholipid specificity

  • Engineering the flexible arms containing W237 and E343 to modify substrate recognition

  • Stabilization of the catalytic core to enhance thermostability

  • Modification of membrane-anchoring domains to improve expression or solubility

When designing such variants, researchers should consider:

How can recombinant Lnt be utilized in lipoprotein research?

Recombinant Lnt from Agrobacterium radiobacter and other bacterial species offers several valuable applications in lipoprotein research:

  • As a tool for in vitro lipoprotein modification:

    • Generation of defined triacylated lipoproteins for structural studies

    • Production of lipidated antigens for vaccine development

    • Creation of lipoproteins with non-natural fatty acids for functional studies

  • As a model system for studying:

    • Membrane enzyme catalysis

    • Ping-pong reaction mechanisms

    • Protein-lipid interactions

  • For comparative studies of lipoprotein processing across bacterial species, particularly between:

    • Gram-negative Proteobacteria where Lnt is essential

    • Other bacterial groups with alternative lipoprotein processing pathways

What potential exists for targeting Lnt in antimicrobial development?

Lnt represents a promising target for antimicrobial development due to several key features:

  • Essential role: Lnt is required for the proper functioning of numerous lipoproteins involved in essential cellular processes in Gram-negative bacteria

  • Increased antibiotic sensitivity: Studies with Lnt mutants in Neisseria meningitidis have demonstrated:

    • 64-fold increase in susceptibility to rifampicin

    • 16-fold increase in susceptibility to ciprofloxacin

    • Suggesting Lnt inhibitors could potentiate existing antibiotics

  • Specificity to Gram-negative bacteria: The N-acylation step catalyzed by Lnt is unique to Gram-negative bacteria, offering potential selectivity

  • Accessible active site: The crystal structures reveal features that could be exploited for inhibitor design, including:

    • The large substrate entry portal

    • The highly conserved catalytic residues

    • The flexible substrate-binding arms

Researchers propose Lnt as a "potential novel drug target for combination therapy with antibiotics," particularly valuable given the increasing prevalence of antibiotic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.