Recombinant Agrobacterium radiobacter ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Agrobacterium radiobacter

Subunit a (encoded by atpB) is essential for proton translocation across the bacterial membrane, driving ATP synthesis . In A. radiobacter, ATP synthase enables energy conservation during aerobic respiration and supports survival in nutrient-limited environments . Key functional insights include:

  • Energy Storage: Polyglucose molecules synthesized during aerobic metabolism rely on ATP synthase activity for chromate reduction, aiding detoxification .

  • Biocontrol Mechanisms: A. radiobacter strain K84 uses ATP-dependent processes to produce agrocin 84, a bacteriocin that inhibits pathogenic Agrobacterium tumefaciens by disrupting DNA replication .

Recombinant Protein Production

The His-tagged atpB protein serves as a tool for:

  • Enzyme Mechanism Studies: Structural analysis of proton channeling in ATP synthase .

  • Antibiotic Development: Screening for ATP synthase inhibitors, inspired by mycobacterial studies where subunit a (atpB) is a validated drug target .

Agricultural Biotechnology

  • Strain Engineering: Genome sequencing of A. radiobacter DSM 30147 T revealed contamination issues in prior assemblies, underscoring the need for high-fidelity recombinant proteins for comparative genomics .

  • Plasmid Stability: Recombinant atpB expression systems avoid plasmid corruption caused by transposons (e.g., Tn904) in Agrobacterium strains like LBA4404 .

Genomic Insights

  • Taxonomic Reclassification: A. radiobacter and A. tumefaciens share >99% average nucleotide identity, suggesting they belong to the same species . This impacts studies on atpB’s role in pathogenicity versus biocontrol.

  • Essentiality: CRISPR interference confirms that atpB knockdown is lethal in mycobacteria, highlighting its universal role in bacterial survival .

Production Challenges

  • Contamination Risks: Earlier A. radiobacter genome assemblies (e.g., ASXY01) contained foreign DNA, complicating functional studies .

  • Expression Toxicity: Strong promoters (e.g., CaMV 35S) in Agrobacterium vectors can destabilize plasmids unless replaced with host-specific promoters like PMA4 .

Future Directions

  • Structural Biology: Cryo-EM studies of recombinant atpB could elucidate proton translocation mechanics.

  • Synthetic Biology: Leveraging A. radiobacter’s metabolic efficiency (e.g., molasses-based media ) for scaled recombinant protein production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Arad_1117; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
Target Names
atpB
Target Protein Sequence
MANGPTHQFLIFKIIPIDIGGIDFSFTNASLFMVASAVLSAGFLYFATSARSVIPGRSQS VAEMAYEFIASMLKEGAGTKGMKFFPLVFSLFMFVLTANLLGMVPYFYTVTSQIIVTFAL ALLVILTVILYGFIKHGFGFLKLFVPQGVPGILLPLVVIIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLGTLGALGIGGAILPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAVHPGGH
Uniprot No.

Target Background

Function
A crucial component of the proton channel, ATP synthase subunit a plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium radiobacter ATP synthase subunit a (atpB) and what is its function?

ATP synthase subunit a (atpB) from Agrobacterium radiobacter is a critical component of the F0 sector of ATP synthase, a fundamental enzyme in cellular bioenergetics. This membrane-embedded protein forms part of the proton channel that converts the energy from proton gradient into the mechanical rotation necessary for ATP synthesis. The full-length protein consists of 250 amino acids and plays an essential role in maintaining the proton motive force across the bacterial membrane .

How does A. radiobacter atpB compare to ATP synthase subunits from other bacterial species?

Agrobacterium radiobacter atpB shares structural and functional conservation with ATP synthase subunits from other bacterial species, particularly within the Rhizobiaceae family. A key distinguishing feature is its hydrophobic profile, as it contains multiple transmembrane segments that anchor it in the membrane. While the core function remains conserved across species, sequence variations in the proton channel-forming regions can affect the efficiency of proton translocation and ATP synthesis rates. Notably, A. radiobacter (also known as Rhizobium radiobacter) is phylogenetically distinct from commonly studied model organisms like E. coli, making its ATP synthase an interesting comparative subject for evolutionary and structural studies .

What are the key considerations when expressing recombinant A. radiobacter atpB in heterologous systems?

Expressing recombinant A. radiobacter atpB in heterologous systems presents several challenges due to its membrane protein nature. The most effective expression system documented is E. coli, which has been successfully used to produce the recombinant protein with an N-terminal His tag . Key considerations include:

  • Expression vector selection: Vectors with tightly regulated promoters (e.g., T7) are preferred to control expression levels and minimize toxicity.

  • Codon optimization: Codon usage should be optimized for the host organism to enhance translation efficiency.

  • Membrane integration: The incorporation of signal sequences may improve membrane targeting.

  • Solubilization strategies: Appropriate detergents must be selected for efficient extraction from membranes.

  • Purification approach: A two-step purification process using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography is recommended for obtaining high purity samples.

Expression in E. coli under controlled temperature conditions (typically 18-25°C post-induction) and using specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) significantly improves yield and proper folding.

How can researchers accurately predict ATP binding sites in atpB using computational methods?

Accurately predicting ATP binding sites in atpB can be accomplished using composite prediction methods that integrate both sequence and structure-based approaches. The ATPbind predictor represents an effective computational strategy that combines multiple support vector machines (SVMs) with a mean-ensemble-based method to address the imbalanced nature of ATP binding data .

For optimal prediction accuracy, researchers should:

  • Generate high-quality structural models using tools like I-TASSER when experimental structures are unavailable

  • Employ template-based predictors such as S-SITE that leverage structural similarities with known ATP-binding proteins

  • Incorporate sequence conservation analysis, as ATP binding residues tend to be conserved across species

  • Use machine learning approaches trained on gold-standard datasets of ATP-binding proteins

  • Apply random undersampling techniques to address the imbalanced ratio between binding and non-binding residues (typically >21:1)

These approaches collectively can achieve prediction accuracies around 72%, covering approximately 62% of all ATP binding sites with Matthews correlation coefficient values significantly higher than individual predictors .

What role does atpB play in the pathogenicity of Agrobacterium radiobacter?

While Agrobacterium radiobacter (Rhizobium radiobacter) is primarily known as a plant pathogen causing stem and crown gall disease in plants such as highbush blueberry, it has also been implicated in human infections, particularly in immunocompromised patients . The atpB protein, as a crucial component of energy metabolism, indirectly contributes to pathogenicity through:

  • Energy provision for virulence factors: ATP generated through ATP synthase powers type IV secretion systems that transfer genetic material during infection

  • Adaptation to host environments: The ability to maintain ATP synthesis under varying pH and oxygen conditions facilitates survival within host tissues

  • Persister cell formation: Metabolic flexibility supported by efficient ATP synthesis contributes to bacterial persistence during antibiotic treatment

It's worth noting that A. radiobacter has been reported as a causative agent in human infections only 36 times in the literature, with most cases involving bacteremia. Other reported conditions include peritonitis, urinary tract infections, endocarditis, cellulitis, and myositis . The relation between atpB function and these pathological manifestations remains an area for further research.

What are the optimal storage and reconstitution conditions for recombinant A. radiobacter atpB?

Optimal storage and reconstitution of recombinant A. radiobacter atpB protein requires careful handling to maintain structural integrity and functional activity. Based on empirical data:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • For multiple uses, aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -80°C with 50% glycerol as a cryoprotectant

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage)

  • Aliquot into smaller volumes based on experimental needs

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C for storage

The reconstituted protein is maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps preserve stability during freeze-thaw cycles .

What techniques are most effective for studying atpB interactions with other ATP synthase subunits?

Investigating atpB interactions with other ATP synthase subunits requires a multi-faceted approach combining biophysical, biochemical, and structural techniques:

TechniqueApplicationAdvantagesLimitations
Chemical cross-linking coupled with mass spectrometryIdentification of spatial proximity between subunitsCan capture transient interactions; works in native-like environmentsMay introduce artifacts; limited spatial resolution
Förster Resonance Energy Transfer (FRET)Real-time monitoring of dynamic interactionsHigh sensitivity; applicable to living cellsRequires fluorophore labeling; potential steric hindrance
Surface Plasmon Resonance (SPR)Quantitative assessment of binding kineticsLabel-free detection; real-time measurementsRequires immobilization of one component
Cryo-electron microscopyStructural determination of the assembled complexNear-atomic resolution; minimal sample preparationTechnically demanding; challenging for membrane proteins
Co-immunoprecipitationVerification of protein-protein interactionsCan be performed under near-physiological conditionsAntibody availability may be limiting

When designing interaction studies, researchers should consider reconstituting atpB in nanodiscs or liposomes to maintain a lipid environment that better mimics physiological conditions, as the protein's hydrophobic nature and multiple transmembrane segments make it challenging to study in aqueous solutions alone.

How can researchers assess the functional activity of recombinant atpB in vitro?

Assessing the functional activity of recombinant atpB requires evaluating its contribution to the ATP synthase complex's ability to facilitate proton translocation and ATP synthesis. Recommended methodologies include:

  • Proton translocation assays:

    • Reconstitute purified atpB with other F0 subunits in liposomes containing pH-sensitive fluorescent dyes

    • Monitor changes in fluorescence intensity that correspond to proton movement across the membrane

    • Quantify proton translocation rates under varying conditions (pH gradients, membrane potential)

  • ATP synthesis activity measurements:

    • Incorporate complete ATP synthase complexes containing the recombinant atpB into liposomes

    • Establish a proton gradient using acid-base transitions or valinomycin-induced K+ diffusion potential

    • Measure ATP production using luciferase-based luminescence assays or enzyme-coupled spectrophotometric methods

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm proper secondary structure formation

    • Limited proteolysis to evaluate the folding state and stability

    • Blue native PAGE to examine complex assembly with other subunits

For comprehensive functional evaluation, researchers should compare the activity of wild-type atpB with site-directed mutants of conserved residues, particularly those in the transmembrane regions involved in proton channel formation.

How should researchers interpret discrepancies in atpB functional data between in vitro and in vivo experiments?

Discrepancies between in vitro and in vivo functional data for atpB are common and require careful interpretation. Several factors contribute to these differences:

  • Membrane environment differences: The lipid composition in artificial membranes rarely matches the complexity of native bacterial membranes, affecting protein conformation and function. In vitro systems may lack specific lipids that modulate atpB function in vivo.

  • Protein-protein interaction network complexity: In vivo, atpB functions within a complex network of interactions that may not be fully reconstituted in vitro. The absence of regulatory proteins or incomplete ATP synthase complex assembly can significantly alter observed activities.

  • Physiological parameters: Factors such as membrane potential, proton gradient, and cellular energy state are tightly regulated in vivo but difficult to precisely control in vitro.

  • Post-translational modifications: Potential modifications that occur in the native context may be absent in recombinant systems, particularly when expressed in heterologous hosts like E. coli.

To address these discrepancies, researchers should:

What statistical approaches are most appropriate for analyzing ATP synthase subunit interaction data?

Analyzing ATP synthase subunit interaction data requires robust statistical methods that account for the complex nature of membrane protein interactions. Recommended approaches include:

  • For multiple comparison scenarios:

    • ANOVA with post-hoc tests (e.g., Tukey's HSD) when comparing interaction strengths across multiple subunit combinations

    • Bonferroni or Holm-Bonferroni correction for controlling family-wise error rates

  • For binding affinity analysis:

    • Non-linear regression models for fitting binding curves (typically using Hill equation or Langmuir isotherm)

    • Bootstrap resampling methods to estimate confidence intervals for binding parameters

    • Information-theoretic approaches (AIC/BIC) to select between competing binding models

  • For structural interaction data:

    • Hierarchical clustering to identify interaction patterns across multiple subunits

    • Principal component analysis to reduce dimensionality and identify key variables driving interactions

    • Bayesian statistical approaches for integrating prior knowledge with experimental data

  • For time-course interaction studies:

    • Time series analysis methods including autocorrelation functions

    • Mixed-effects models to account for both fixed and random factors in experimental design

When presenting statistical results, researchers should report effect sizes alongside p-values and clearly state the null hypotheses being tested. This comprehensive approach ensures that subtle but biologically significant interaction patterns are not overlooked.

What are common challenges in purifying recombinant A. radiobacter atpB and how can they be overcome?

Purification of recombinant A. radiobacter atpB presents several challenges due to its hydrophobic nature and membrane-embedded characteristics. Common issues and their solutions include:

ChallengeCauseSolution
Low expression yieldToxicity to host cells; protein aggregationUse tightly regulated expression systems; lower induction temperature to 16-18°C; use specialized E. coli strains (C41/C43)
Protein aggregationImproper folding; hydrophobic interactionsAdd mild detergents during lysis; include stabilizing agents like glycerol (5-10%) and trehalose (6%)
Poor solubilizationInadequate detergent selectionScreen multiple detergents (DDM, LDAO, C12E8); optimize detergent:protein ratio
Low purityNon-specific binding to purification resinInclude low concentrations of detergent and salt in wash buffers; consider two-step purification
Protein precipitation during concentrationDetergent concentration; protein instabilityKeep protein concentration <5 mg/mL; use centrifugal concentrators with appropriate MWCO; add stabilizing agents
Loss of activity after purificationDenaturation; loss of essential lipidsInclude lipid during purification and storage; consider nanodiscs for stabilization

To achieve >90% purity as typically required for structural and functional studies, researchers should implement a rigorous optimization strategy for each purification step, carefully monitoring protein quality via SDS-PAGE at each stage .

How can researchers optimize heterologous expression systems for improved atpB yield and quality?

Optimizing heterologous expression of A. radiobacter atpB requires systematic adjustment of multiple parameters to balance protein yield with proper folding and activity:

  • Expression vector optimization:

    • Test multiple promoter strengths (T7, tac, ara)

    • Incorporate fusion partners that enhance solubility (MBP, SUMO)

    • Include a well-designed linker between the His-tag and atpB sequence

    • Consider codon optimization for the expression host

  • Host strain selection:

    • Compare specialized membrane protein expression strains (C41/C43)

    • Evaluate strains with altered membrane compositions

    • Consider strains with reduced protease activity or rare codon supplementation

  • Culture conditions optimization:

    • Implement factorial design experiments to simultaneously test:

      • Induction optical density (typically 0.6-0.8)

      • Inducer concentration (0.1-1.0 mM IPTG)

      • Growth temperature (16-30°C)

      • Media composition (LB, TB, autoinduction media)

      • Duration of expression (4-24 hours)

  • Scale-up considerations:

    • Monitor oxygen transfer rates in larger vessels

    • Adjust agitation and aeration parameters

    • Implement fed-batch strategies to maintain controlled growth

For highest quality protein preparation, expression in E. coli at reduced temperatures (18°C) after induction, using rich media supplemented with glucose (0.2%) during the growth phase and switching to lactose or IPTG induction, has proven effective for membrane proteins like atpB .

What are the critical factors affecting protein-ATP binding site prediction accuracy, and how can they be improved?

Protein-ATP binding site prediction faces several challenges that affect accuracy. Understanding these factors is crucial for improving prediction models:

  • Imbalanced data representation:

    • ATP binding residues typically constitute <5% of total residues in proteins

    • This imbalance (>21:1 ratio of non-binding to binding residues) skews classifier performance

    • Solution: Implement mean-ensemble-based methods with random undersampling techniques to balance training data

  • Structural flexibility:

    • ATP binding often involves conformational changes not captured in static structures

    • Solution: Incorporate molecular dynamics simulations to model flexibility; use ensemble approaches

  • Physiochemical property consideration:

    • ATP binding sites exhibit specific physiochemical properties (charge, hydrophobicity, etc.)

    • Solution: Develop feature vectors that comprehensively capture these properties

  • Template availability:

    • Prediction accuracy correlates with the availability of resolved structures of homologous proteins

    • Solution: Combine multiple template-based approaches (e.g., S-SITE) with sequence-based predictors

  • Algorithm selection:

    • Different machine learning approaches have varied success with ATP binding prediction

    • Solution: Implement composite approaches that integrate support vector machines with deep learning architectures

Researchers have demonstrated that composite predictors like ATPbind, which integrate these considerations, can achieve significantly improved performance with Matthews correlation coefficient values higher than individual predictors, reaching accuracy levels of 72% while covering 62% of all ATP binding sites .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.