Recombinant Agrobacterium radiobacter Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Cobalamin Synthase (CobS)

Cobalamin synthase (CobS) is a critical enzyme in the biosynthesis of adenosylcobalamin (AdoCbl), the coenzyme form of vitamin B₁₂. This enzyme catalyzes the condensation of α-ribazole-phosphate (α-RP) and adenosylcobinamide-GDP (AdoCbi-GDP) to form adenosylcobalamin-5′-phosphate (AdoCbl-P), the penultimate step in B₁₂ synthesis . CobS is a polytopic membrane protein conserved across bacteria and archaea, reflecting its essential role in energy metabolism and anaerobic fermentation .

In Agrobacterium radiobacter, CobS operates within the nucleotide loop assembly (NLA) pathway, a membrane-associated process critical for B₁₂-dependent functions . Recombinant CobS refers to the enzyme produced via genetic engineering, enabling studies on its structure, function, and applications in biotechnology.

Biochemical Characteristics of Recombinant CobS

Recombinant A. radiobacter CobS shares structural and functional homology with CobS orthologs in other bacteria:

  • Molecular Weight: Estimated at ~50 kDa (based on E. coli homologs) .

  • Membrane Localization: Integral membrane protein with multiple transmembrane domains .

  • Catalytic Activity: Requires a multienzyme complex involving CobC (phosphatase) for full functionality .

Table 1: Key Properties of CobS

PropertyDescription
GenecobS (part of the cob operon)
ReactionAdoCbi-GDP + α-RP → AdoCbl-P + GDP
CofactorsMg²⁺-dependent
pH Optimum7.0–7.5 (inferred from E. coli studies)
ThermostabilityStable at ≤37°C; activity declines sharply at >45°C

3.1. Membrane Association and Proton Motive Force (PMF) Dissipation

Overexpression of CobS in E. coli leads to PMF collapse and membrane destabilization due to improper integration of the enzyme into lipid bilayers . Key findings include:

  • PMF Disruption: Ethidium bromide uptake assays showed a 3.5-fold increase in cytoplasmic dye accumulation in CobS-overexpressing cells .

  • Rescue Mechanisms: Coexpression with CobC (phosphatase) or PspA (phage shock protein A) restored membrane integrity by enhancing enzymatic turnover or stabilizing PMF .

4.1. Metabolic Engineering

Recombinant CobS enables:

  • B₁₂ Production: Optimization of industrial B₁₂ biosynthesis in engineered strains .

  • Anaerobic Fermentation: Enhanced pathways for propionate or ethanolamine utilization in synthetic biology .

4.2. Challenges in Recombinant Expression

  • Toxicity: High CobS levels impair host viability, necessitating tightly regulated promoters (e.g., tetracycline-inducible systems) .

  • Complex Assembly: Requires coexpression with CobC for efficient AdoCbl synthesis .

Future Directions

  1. Structural Resolution: Cryo-EM studies to elucidate CobS-CobC interaction mechanisms.

  2. Host Optimization: Engineered A. radiobacter strains with PMF-stabilizing genes (e.g., pspA) for scalable CobS production .

  3. Bioremediation: Leveraging CobS in B₁₂-dependent pathways for environmental applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, and for lyophilized forms, it is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
cobS; Arad_2734; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
Target Names
cobS
Target Protein Sequence
MNIREYTSDVARAVAFLSRIPVPASFFEGDDGKLARVSRAFPLAGLLIALPAAITFGVLL AFDADPLMAALLALAIQTVTTGALHEDGLSDTADGLGGGKDRDRALAIMKDSRIGTYGAV ALILSFGLRAAALAAIGRGLAPLDAALTIPAAAVLSRGAMVWHWYALPAAKPDGVAASAG KPDYGPMQIALIAALILSAFLLWPSLRLPAFVLCLLVTVVAAFLFTRHVRQRLSGHTGDT IGAAQQICEIAAFCTLAMCV
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) is an enzyme that catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Cobalamin synthase (cobS) in bacterial metabolism?

Cobalamin synthase (cobS) is a crucial enzyme in the final stages of the vitamin B12 (cobalamin) biosynthetic pathway. It catalyzes the incorporation of cobalt into the corrin ring structure, which is essential for forming functional cobalamin molecules. In bacterial species like Mycobacterium smegmatis, cobalamin functions as a cofactor for various enzymes including MetH, a methionine synthase that catalyzes the final reaction in methionine biosynthesis. This enzyme works alongside MetE, a cobalamin-independent methionine synthase, with their expression regulated by cobalamin availability through riboswitch mechanisms . The presence of cobS in bacteria indicates their capacity for de novo vitamin B12 synthesis, an essential micronutrient for various metabolic processes.

Why study Agrobacterium radiobacter as a source for recombinant cobS?

Agrobacterium radiobacter represents a valuable source for recombinant cobS due to several characteristics. A. radiobacter strains possess diverse plasmids ranging in molecular weight from 50 × 10^6 to 182 × 10^6 daltons, with some strains containing multiple plasmids of different sizes . This genetic diversity suggests potential variations in metabolic capabilities, including cobalamin synthesis. Studies have shown that these plasmids exhibit varying degrees of homology with those from other bacterial species, indicating unique genetic adaptations that may have evolved specialized versions of biosynthetic enzymes like cobS . These natural variations could provide enzymes with distinct catalytic properties, stability characteristics, or substrate specificities valuable for biotechnological applications.

How does the cobS gene integrate into the cobalamin biosynthetic pathway?

The cobS gene encodes a critical enzyme in the later stages of the cobalamin biosynthetic pathway, functioning within a complex network of enzymes encoded by dedicated gene clusters. In bacteria like Bacillus megaterium, cobalamin biosynthesis involves genes within the cobI operon including cbiA, cbiD, cbiF, cbiJ, cbiL, and cysGA . These genes work in concert to produce the corrin ring structure to which cobalt is incorporated. The cobS enzyme typically works downstream of these initial biosynthetic steps, integrating cobalt into the macrocycle to form the functional coenzyme. The entire pathway requires precise coordination with other cellular processes, particularly those involving metal ion homeostasis, as exemplified by the ability of some bacteria to transport and assimilate exogenous cobalamin and its precursors when available in the environment .

What expression systems are most effective for producing recombinant A. radiobacter cobS?

For recombinant expression of A. radiobacter cobS, an Escherichia coli-based expression system offers the most versatile platform based on successful approaches with similar enzymes. The recommended methodology includes:

  • Gene amplification using PCR with primers designed from conserved cobS sequences identified through BLAST analysis

  • Cloning into expression vectors such as pRSFDuet-1, which provides tight regulation of expression

  • Transformation into E. coli BL21(DE), a strain optimized for protein expression

  • Induction with IPTG at concentrations around 0.1 mM

  • Incubation at lower temperatures (28°C) with gentle agitation (80 rpm) for 18-24 hours to enhance proper protein folding

This approach mirrors successful strategies used for other recombinant proteins from soil bacteria, such as carboxypeptidase G from Variovorax sp. F1, which yielded functional enzyme when expressed under similar conditions . Verification of expression should include SDS-PAGE analysis to confirm the anticipated molecular weight of the recombinant protein followed by activity assays.

What purification strategies yield highest activity for recombinant cobS?

A multi-step purification strategy is essential for obtaining high-activity recombinant cobS enzyme:

Purification StepTechniquePurposeBuffer Components
Initial CaptureAffinity chromatography (His-tag)Selective binding of tagged protein50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10 mM imidazole
Intermediate PurificationIon exchange chromatographySeparation based on charge20 mM Tris-HCl (pH 8.0), 0-500 mM NaCl gradient
PolishingSize exclusion chromatographyRemoval of aggregates and final purification20 mM Tris-HCl (pH 7.5), 150 mM NaCl
Special ConsiderationsAddition of cobalt ions and reducing agentsMaintaining enzyme structure and activity2-5 μM CoCl₂, 1-5 mM DTT or β-mercaptoethanol

Throughout purification, it's crucial to monitor enzyme activity using appropriate assays to ensure the protein remains functional. The final preparation should be stored with 20-30% glycerol at -80°C in small aliquots to prevent freeze-thaw damage. Purified cobS enzyme should be characterized by its specific activity (μmol product/min/mg protein) to establish baseline performance metrics for subsequent experiments .

How should researchers optimize cobalt incorporation for maximum cobS activity?

Cobalt incorporation is critical for cobS functionality and requires careful optimization:

  • Expression phase optimization:

    • Supplement growth media with 5-20 μM CoCl₂ during induction

    • Monitor potential toxicity by comparing growth curves at different cobalt concentrations

    • Consider gradual addition of cobalt during extended expression periods

  • Purification considerations:

    • Include 1-5 μM cobalt in all purification buffers to prevent metal loss

    • Avoid strong metal chelators like EDTA in buffers containing the enzyme

    • Consider mild reducing conditions to maintain proper oxidation state of cobalt

  • Activity enhancement:

    • Determine optimal cobalt:protein ratio through titration experiments

    • Test various cobalt salts (chloride, acetate, sulfate) for differential effects

    • Investigate potential synergistic effects with other divalent cations or cofactors

Spectroscopic methods such as UV-visible spectroscopy can be used to monitor successful cobalt incorporation, as metallated cobalamin synthase typically exhibits characteristic absorption features distinct from the apo-enzyme. ICP-MS (Inductively Coupled Plasma Mass Spectrometry) analysis can provide quantitative assessment of metal content in the purified enzyme preparation .

How does the genetic context of cobS differ between A. radiobacter and other bacterial species?

The genetic organization surrounding the cobS gene can provide insights into regulatory mechanisms and metabolic integration:

In Agrobacterium radiobacter, as with other soil bacteria, the cobS gene likely exists within a larger cobalamin biosynthetic gene cluster. While specific information about A. radiobacter cobS is limited in the search results, comparative genomics with related species suggests potential arrangements:

  • Plasmid versus chromosomal location:

    • A. radiobacter possesses various plasmids ranging from 50 × 10^6 to 182 × 10^6 daltons

    • Some strains contain multiple plasmids that may harbor different components of the cobalamin synthesis pathway

    • Hybridization studies have shown varying degrees of homology between A. radiobacter plasmids and those from other bacterial species

  • Operon structure:

    • In Bacillus megaterium, cobalamin genes are organized in the cobI operon containing genes like cbiA, cbiD, cbiF, cbiJ, cbiL, and cysGA

    • Mycobacterium species exhibit a different organization with cobalamin biosynthesis genes potentially regulated by cobalamin-sensing riboswitches

  • Regulatory elements:

    • Cobalamin metabolism in M. tuberculosis involves riboswitch-mediated control of gene expression (particularly affecting the balance between MetH and MetE enzymes)

    • Similar regulatory mechanisms may exist in A. radiobacter, potentially with adaptations specific to its ecological niche

Understanding these genomic contexts is essential for designing optimal expression constructs and interpreting the metabolic role of cobS in A. radiobacter.

What kinetic parameters characterize recombinant A. radiobacter cobS activity?

Characterizing the kinetic parameters of recombinant A. radiobacter cobS provides fundamental insights into its catalytic mechanism and efficiency. While specific data for A. radiobacter cobS is not provided in the search results, a comprehensive kinetic analysis should include:

  • Steady-state kinetics:

    • Determination of Km and kcat values for all substrates including the corrin precursor and ATP

    • Analysis of reaction velocity under varying substrate concentrations

    • Assessment of potential cooperativity or allosteric effects

  • Metal dependence:

    • Cobalt concentration effects on activity

    • Inhibition profiles with competing metals

    • Binding constants for metal cofactors

  • Environmental parameter effects:

    • pH-activity profile to determine optimal conditions

    • Temperature effects on reaction rate and stability

    • Buffer composition influences on activity

A similar approach was employed for characterizing pterin deaminase from Variovorax sp. F1, where researchers determined Km values of 0.28 ± 0.06 mM and kcat values of 10.1 ± 0.4 s⁻¹ for folic acid, demonstrating substrate preference through comparative kinetic analysis . This methodological framework can be applied to cobS characterization, adapting specific assay conditions to the biochemical properties of the cobalamin synthesis reaction.

How does cobS enzyme structure correlate with its function in cobalamin synthesis?

Understanding the structure-function relationship of cobS provides insights for enzyme engineering and optimization:

  • Structural domains and motifs:

    • Cobalamin synthases typically contain nucleotide-binding domains for ATP utilization

    • Metal-binding motifs for cobalt coordination

    • Substrate-binding regions specific to corrin ring precursors

    • Potential dimerization or oligomerization interfaces

  • Catalytic mechanism implications:

    • Active site architecture determining substrate specificity

    • Conformational changes during catalysis

    • Structural basis for potential rate-limiting steps

  • Comparative structural biology:

    • Homology with cobalamin synthases from other bacterial species

    • Structural adaptations potentially related to ecological niche

    • Conservation patterns correlating with enzymatic properties

  • Structure-guided engineering approaches:

    • Identification of residues critical for thermal stability

    • Target sites for enhancing catalytic efficiency

    • Regions amenable to modification for biotechnological applications

While crystal structures for A. radiobacter cobS are not reported in the search results, structural analysis through homology modeling based on related enzymes can guide experimental design for site-directed mutagenesis and functional characterization studies.

What are the most reliable assays for measuring recombinant cobS activity?

Several complementary approaches can be employed to reliably measure cobS enzymatic activity:

  • Direct activity assays:

    • HPLC separation of substrates and products with UV-visible detection

    • LC-MS analysis for definitive identification of reaction products based on molecular weight and fragmentation patterns

    • Radioisotope incorporation assays using ⁵⁷Co or ⁶⁰Co

  • Coupled enzyme assays:

    • Systems linking cobS activity to more easily detectable enzymatic reactions

    • ATP consumption monitoring through coupled phosphorylation reactions

    • Spectrophotometric detection using appropriate chromogenic or fluorogenic substrates

  • Specialized detection methods:

    • UV-visible spectroscopy to monitor changes in absorption spectra during catalysis

    • Fluorescence-based approaches for enhanced sensitivity

    • NMR spectroscopy for structural confirmation of products

Similar methodological approaches have been successfully applied to characterize other enzymes involved in complex metabolic pathways, such as the LC-MS methods used to identify products of pterin deaminase from Variovorax sp. F1, where parent mass ion peaks and characteristic fragments confirmed the identity of reaction products . Activity assays should include appropriate controls and be validated for linearity with respect to enzyme concentration and reaction time.

How can researchers differentiate between active and inactive forms of recombinant cobS?

Distinguishing active from inactive forms of recombinant cobS requires multiple analytical approaches:

Assessment MethodTechniqueInformation ProvidedExample Application
Activity AssaysLC-MS, HPLC, spectrophotometricDirect measurement of catalytic functionQuantification of product formation rate
Metal Content AnalysisICP-MS, atomic absorptionQuantification of incorporated cobaltDetermination of metal:protein stoichiometry
Structural IntegrityCD spectroscopy, fluorescenceSecondary/tertiary structure assessmentDetection of misfolding or denaturation
Oligomeric StateSize exclusion chromatographyDetection of aggregation or incorrect assemblyIdentification of functional oligomeric forms
Thermal StabilityDifferential scanning fluorimetryMelting temperature determinationComparison between active and inactive preparations
Ligand BindingIsothermal titration calorimetrySubstrate and cofactor binding affinitiesVerification of functional binding sites

By systematically applying these complementary methods, researchers can comprehensively characterize the molecular basis for activity differences and develop strategies to maximize the proportion of active enzyme in their preparations. This multi-faceted approach is essential given the complexity of cobS function, which depends on proper protein folding, metal incorporation, and maintenance of specific structural features .

What potential contaminants might interfere with cobS activity assays?

Several contaminants can potentially interfere with cobS activity assays, requiring specific mitigation strategies:

  • Metal contaminants:

    • Competing metals (Zn²⁺, Cu²⁺, Ni²⁺) may displace cobalt from the enzyme

    • Mitigation: Use high-purity reagents, treat buffers with chelating resins prior to adding the specific metals required

    • Verification: ICP-MS analysis of final buffer compositions

  • Endogenous E. coli proteins:

    • Host metallochaperones or metal-binding proteins may sequester cobalt

    • Metal-dependent enzymes may generate interfering activities

    • Mitigation: Rigorous purification protocols, Western blot analysis to confirm purity

  • Oxidizing agents:

    • Oxidation of critical thiol groups can inactivate cobS

    • Atmospheric oxygen can affect cobalt oxidation state

    • Mitigation: Include reducing agents (DTT or β-mercaptoethanol), work under anaerobic conditions when possible

  • Nucleic acid contaminants:

    • DNA/RNA can bind to cobS and affect activity

    • May introduce metal-binding competitors

    • Mitigation: Include nuclease treatment steps, additional purification by ion exchange chromatography

Similar challenges have been addressed in the characterization of other metalloenzymes, where careful purification and assay design were essential for reliable activity measurements. All assay systems should include appropriate positive and negative controls to account for potential interference .

How should researchers address inconsistent results in cobS characterization studies?

When facing inconsistent results in cobS characterization, a systematic troubleshooting approach is essential:

  • Variability assessment:

    • Calculate coefficient of variation (CV) for replicate measurements

    • Determine if variability exceeds expected range for the specific assay

    • Implement statistical analysis to evaluate significance of differences

  • Source identification:

    • Enzyme preparation: Compare multiple independently prepared batches

    • Assay components: Test different lots of reagents, substrates, and buffers

    • Environmental factors: Monitor and control temperature, light exposure, and oxygen levels

  • Protein quality analysis:

    • Reassess protein purity by orthogonal methods (SDS-PAGE, mass spectrometry)

    • Evaluate protein stability during storage and throughout experiments

    • Confirm metal content and oxidation state by ICP-MS or similar techniques

  • Methodological refinement:

    • Standardize protocols with detailed standard operating procedures

    • Implement internal standards for quantitative assays

    • Consider alternative assay methods less susceptible to interference

Similar troubleshooting approaches have proved effective in characterizing other complex enzyme systems, such as the pterin deaminase from Variovorax sp. F1, where researchers reported kinetic parameters with standard deviations (e.g., Km = 0.28 ± 0.06 mM), demonstrating the importance of statistical analysis in evaluating experimental reproducibility .

What factors affect the stability of recombinant cobS during purification and storage?

Multiple factors can impact cobS stability, requiring careful optimization:

  • Buffer composition effects:

    • pH: Typically optimal between 7.0-8.0 for most metalloenzymes

    • Ionic strength: Usually 50-300 mM NaCl to prevent aggregation without destabilizing structure

    • Buffering agent: Phosphate buffers should be avoided due to potential metal precipitation

  • Metal cofactor considerations:

    • Maintain appropriate cobalt concentration (1-5 μM) in all buffers

    • Consider the oxidation state of cobalt (Co²⁺ vs. Co³⁺)

    • Avoid strong metal chelators in storage buffers

  • Oxidative damage prevention:

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol)

    • Consider oxygen-free environments for long-term storage

    • Add antioxidants like ascorbate for additional protection

  • Temperature effects:

    • Avoid freeze-thaw cycles by preparing small aliquots

    • Storage at -80°C typically provides better stability than -20°C

    • Addition of 20-30% glycerol or other cryoprotectants

  • Protein concentration factors:

    • Higher concentrations (>1 mg/mL) often show better stability

    • Excessive concentration may promote aggregation

    • Optimal concentration range should be determined empirically

Similar stability considerations have been important in characterizing other biosynthetic enzymes, where proper storage conditions were essential for maintaining activity over time .

How do genetic variations in cobS across Agrobacterium strains affect enzyme function?

Genetic variations in cobS between different Agrobacterium strains can significantly impact enzyme properties and function:

  • Sequence diversity implications:

    • Variations in the catalytic domain may alter substrate specificity or catalytic efficiency

    • Mutations in metal-binding motifs could affect cobalt coordination and incorporation

    • Changes in regulatory regions might influence expression patterns under different environmental conditions

  • Plasmid-associated variations:

    • A. radiobacter strains contain plasmids of different molecular weights (50 × 10^6 to 182 × 10^6 daltons)

    • Some strains harbor multiple plasmids that may carry different cobS variants

    • Hybridization studies show varying degrees of homology between plasmids from different strains

  • Functional consequences:

    • Kinetic parameter differences (Km, kcat) affecting catalytic efficiency

    • Thermal stability variations influencing enzyme longevity

    • Altered regulatory responses to environmental signals

    • Differential susceptibility to inhibitors

Comparative analysis across strains, similar to the hybridization studies conducted for A. radiobacter plasmids, can reveal the relationship between sequence diversity and functional properties . This information is valuable for selecting optimal natural variants for recombinant expression or for guiding protein engineering efforts to enhance specific properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.