Recombinant Agrobacterium radiobacter Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
mscL; Arad_0821; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
Target Names
mscL
Target Protein Sequence
MLNEFKAFIAKGNVMDLAVGVIIGGAFGGIVKSLVDDIIMPIVGAIFGGFDFSNYFLGLS SAVNAPTLAGARAQGAVLAYGSFITVLINFLILAWIIFLMVKGVNTLRAQVERKDNKVAE AAPPPADVQLLTEIRDLLAKR
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the Large-conductance mechanosensitive channel (mscL) in Agrobacterium radiobacter?

The Large-conductance mechanosensitive channel (mscL) in Agrobacterium radiobacter is a membrane protein that forms a non-selective channel which opens in response to membrane tension. The protein typically consists of five identical subunits arranged around a central pore. Each subunit contains two transmembrane domains connected by a periplasmic loop, with cytoplasmic N-terminal and C-terminal domains. When membrane tension increases beyond a threshold, the channel undergoes a conformational change from a closed to an open state, creating a pore approximately 30 Å in diameter.

The primary function of mscL is to act as an emergency release valve, protecting bacterial cells from osmotic shock by allowing the rapid efflux of cytoplasmic solutes when cells experience hypoosmotic stress. This prevents cell lysis by reducing turgor pressure. In Agrobacterium radiobacter, this mechanism is particularly important as the bacterium transitions between soil environments with varying osmolarities .

What expression systems are most effective for producing recombinant A. radiobacter mscL?

For producing recombinant A. radiobacter mscL, several expression systems have proven effective, each with specific advantages depending on research goals:

  • E. coli-based expression systems: The BL21(DE3) strain using pET vectors with T7 promoters offers high protein yields when mscL is fused with tags such as His6 or MBP to facilitate purification. Optimal expression is typically achieved at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.3 mM) to prevent inclusion body formation.

  • Cell-free expression systems: These provide an alternative approach that bypasses toxicity issues often encountered with membrane protein overexpression in living cells. Commercial wheat germ or E. coli extract-based systems supplemented with lipids or detergents can produce functional mscL directly in a membrane-like environment.

  • Agrobacterium-based expression: Homologous expression using modified Agrobacterium tumefaciens strains such as GV3101 allows for native-like folding. This approach is particularly valuable for structural studies requiring authentic post-translational modifications .

The effectiveness of each system can be assessed by monitoring expression levels through Western blotting and functional analysis through patch-clamp electrophysiology or fluorescence-based flux assays.

What purification strategies yield the highest purity and activity of recombinant mscL proteins?

Achieving high purity and activity of recombinant A. radiobacter mscL requires a carefully designed purification strategy addressing the challenges of membrane protein isolation:

  • Membrane preparation: Efficient cell lysis using a combination of enzymatic (lysozyme) and mechanical (sonication or high-pressure homogenization) methods, followed by differential centrifugation to isolate membrane fractions.

  • Detergent solubilization: A two-phase screening approach is recommended:

    • Initial screening with mild detergents (DDM, LMNG, or C12E8) at concentrations 2-5× their CMC

    • Secondary optimization using stability assays (SEC-MALS, thermal shift) to identify conditions maintaining the pentameric assembly

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resins with gradual imidazole gradients (20-300 mM) minimizes co-purification of contaminants.

  • Size exclusion chromatography: Critical final polishing step using Superdex 200 columns to separate monomeric, pentameric, and aggregated species.

A typical purification protocol yields approximately 1-2 mg of homogeneous pentameric mscL per liter of E. coli culture with >95% purity as assessed by SDS-PAGE and SEC-MALS analysis. Retention of activity can be verified through reconstitution into liposomes followed by patch-clamp analysis or fluorescence-based flux assays using calcein-loaded vesicles .

How can I confirm the correct folding and functionality of recombinant A. radiobacter mscL?

Confirming proper folding and functionality of recombinant A. radiobacter mscL requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure composition (~70% α-helical content expected)

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm the pentameric assembly (~85-95 kDa for detergent-protein complex)

    • Thermal stability assays using differential scanning fluorimetry with membrane protein-compatible dyes (CPM assay)

  • Functional characterization:

    • Patch-clamp electrophysiology after reconstitution into planar lipid bilayers or liposomes, applying negative pressure to measure channel conductance (~3 nS in 200 mM KCl)

    • Fluorescence-based osmotic shock assays using calcein-loaded proteoliposomes subjected to hypoosmotic conditions

    • In vivo complementation assays in mscL-deficient E. coli strains exposed to osmotic downshock (survival rate measurement)

  • Ligand binding studies:

    • Microscale thermophoresis or isothermal titration calorimetry to quantify interactions with known mechanosensitive channel modulators

    • Site-directed spin labeling combined with EPR spectroscopy to monitor conformational changes

A successfully folded and functional mscL should demonstrate characteristic channel conductance of 2.5-3.5 nS with a tension threshold for activation of 10-12 mN/m when reconstituted in azolectin liposomes, and show clear protection against osmotic downshock in complementation assays .

What are the optimal conditions for reconstituting A. radiobacter mscL into lipid bilayers for electrophysiological studies?

Successful reconstitution of A. radiobacter mscL into lipid bilayers for electrophysiological studies requires precise control of multiple parameters:

  • Lipid composition optimization:

    • A base mixture of synthetic lipids (POPC:POPE at 7:3 ratio) provides a stable bilayer with appropriate fluidity

    • Incorporation of negatively charged lipids (10-15% POPG) enhances channel insertion efficiency

    • Addition of short-chain lipids (5% lysophosphatidylcholine) can lower activation threshold for easier recording

  • Reconstitution method selection:

    • Detergent-mediated reconstitution using Bio-Beads SM-2 for gradual detergent removal yields uniform proteoliposomes

    • Protein:lipid ratios should be optimized between 1:200 and 1:1000 (w/w), with lower ratios preferred for single-channel recordings

    • Dehydration-rehydration methods for planar bilayer formation show higher success rates than painting methods

  • Buffer composition effects:

    Buffer ComponentOptimal RangeEffect on Channel Properties
    KCl150-300 mMDetermines conductance magnitude
    MgCl₂1-5 mMStabilizes closed state
    HEPES10-20 mMMaintains pH 7.2-7.4
    EDTA0.1-1 mMChelates trace divalent contaminants
    pH7.2-7.4Affects gating kinetics
  • Recording conditions:

    • Temperature control between 20-25°C improves signal:noise ratio

    • Applied membrane tension via negative pressure (suction) ranging from 50-200 mmHg

    • Symmetric vs. asymmetric salt conditions depending on experimental goals

A systematic optimization approach testing these parameters reveals that A. radiobacter mscL exhibits maximal activity and stability when reconstituted in POPC:POPE:POPG (7:2:1) liposomes at a protein:lipid ratio of 1:500 (w/w), with gradual detergent removal over 4-6 hours at 4°C using Bio-Beads. Under these conditions, channel openings can be reliably detected at -100 mmHg applied pressure with characteristic conductance of approximately 3.0 nS in 200 mM KCl .

How do mutations in the transmembrane domains of A. radiobacter mscL affect channel gating properties?

Mutations in the transmembrane domains of A. radiobacter mscL produce distinct alterations in channel gating properties that provide insights into structure-function relationships:

  • Hydrophobic pore constriction mutations:

    • Substitutions at the G22 position (equivalent to E. coli G22) in the first transmembrane domain (TM1) significantly alter gating tension thresholds

    • G22S mutants demonstrate a 25-35% reduction in gating tension threshold

    • G22N mutations cause even more dramatic effects, lowering activation pressure by 40-50%

    • These substitutions destabilize the hydrophobic gate through increased hydration of the pore

  • Transmembrane helix-helix interface mutations:

    Mutation RegionSpecific MutationsFunctional EffectActivation Threshold Change
    TM1-TM1 interfaceL19K, A20KDestabilizes closed state-40 to -60%
    TM1-TM2 interfaceI25N, F78SAlters helix packing-30 to -45%
    TM2-TM2 interfaceL89W, I92WDisrupts intersubunit contacts-20 to -35%
    Cytoplasmic end of TM1R13D, K16DAffects cytoplasmic gate+10 to +25%
  • Gain-of-function vs. loss-of-function phenotypes:

    • Hydrophilic substitutions at pore-lining residues typically produce gain-of-function phenotypes with spontaneous channel activity

    • Substitutions that enhance interhelical packing forces generally produce loss-of-function phenotypes requiring greater tension for activation

    • Double mutations following these principles produce additive or sometimes synergistic effects

  • Mechanistic implications:
    Patch-clamp analysis of mutant channels reconstituted in azolectin liposomes reveals distinct kinetic signatures. For example, G22S mutants show not only reduced activation thresholds but also altered subconductance states, suggesting that this residue plays a role in both the energy barrier to opening and the stability of intermediate states during the gating transition. These findings support an iris-like expansion model for channel opening where TM1-TM1 interactions form the primary energy barrier to channel opening .

What strategies can improve heterologous expression yields of A. radiobacter mscL for structural studies?

Maximizing heterologous expression yields of A. radiobacter mscL for structural studies requires a multi-faceted approach addressing membrane protein-specific challenges:

  • Genetic construct optimization:

    • Codon optimization based on expression host (CAI >0.8) increases translation efficiency

    • Addition of N-terminal fusion partners (MBP, SUMO, or Mistic) enhances membrane targeting

    • Incorporation of TEV or PreScission protease sites for tag removal without residual amino acids

    • C-terminal His8 tags show better purification efficiency than N-terminal His6 tags

  • Expression host engineering:

    • C41(DE3) and C43(DE3) E. coli strains with mutations in the T7 RNA polymerase reduce toxicity

    • Lemo21(DE3) strain with tunable T7 RNA polymerase activity through rhamnose-inducible lysozyme

    • Co-expression of chaperones (GroEL/GroES) and protein disulfide isomerase enhances correct folding

  • Cultivation conditions optimization:

    ParameterConventional ApproachOptimized ApproachYield Improvement
    Temperature37°C standard18-20°C post-induction2.5-3×
    MediaLB brothTB or EnPresso3-4×
    Induction1.0 mM IPTG0.1 mM IPTG or auto-induction
    AdditivesNone5% glycerol, 0.5% glucose1.5-2×
    AerationBaffled flasksFed-batch fermentation5-8×
  • Solubilization and stabilization strategies:

    • Systematic detergent screening beyond conventional options

    • Thermostability assays to identify stabilizing buffer conditions

    • Addition of specific lipids (cardiolipin, cholesterol) during solubilization

    • Nanodiscs or SMALP formation for detergent-free extraction

Implementation of these optimizations can increase yields from the typical 0.5-1 mg/L to 8-10 mg/L of purified, homogeneous A. radiobacter mscL. The highest yields are achieved using C41(DE3) cells with an MBP-fusion construct in EnPresso medium, with induction at OD600 = 0.6-0.8 using 0.1 mM IPTG, followed by expression at 18°C for 16-20 hours. This approach produces sufficient protein for crystallization trials or cryo-EM studies while maintaining proper folding and functionality .

How can molecular dynamics simulations enhance our understanding of A. radiobacter mscL gating mechanisms?

Molecular dynamics (MD) simulations provide critical insights into A. radiobacter mscL gating mechanisms that complement experimental approaches:

  • Simulation system setup optimization:

    • All-atom simulations in explicit lipid bilayers (POPC:POPE) require 500-800 lipids for a pentameric channel

    • Careful equilibration protocols (10-20 ns with positional restraints on protein backbone)

    • Production runs of minimally 100-200 ns to capture initial conformational changes

    • Enhanced sampling techniques (metadynamics, umbrella sampling) to overcome energy barriers

  • Lateral tension protocols for gating studies:

    • Constant area simulations with incrementally increased box dimensions

    • Surface tension methods applying negative pressure to the simulation box

    • Force-probe methods directly applied to lipid headgroups

    • Comparison between methods reveals that surface tension approaches most closely match experimental data

  • Key mechanistic insights from simulations:

    Structural FeatureSimulation ObservationFunctional Implication
    Pore hydrationInitial hydration at 10-15 mN/m tensionPrecedes major conformational change
    TM1 tilting15-25° increase in helix tilt anglesInitiates iris-like expansion
    Subconductance statesStable intermediates at 15-20 mN/mMultiple energetic barriers in gating pathway
    N-terminal dynamicsForms dynamic cytoplasmic gateSecondary gating mechanism
    Lipid-protein interactionsSpecific binding sites for POPEExplains lipid composition sensitivity
  • Comparison with experimental data validation:

    • Predicted tension thresholds (10-15 mN/m) align with patch-clamp measurements

    • Calculated conductance from simulated open states (2.8-3.2 nS) matches experimental values

    • Mutation effects can be retrospectively rationalized by energy decomposition analysis

Recent coarse-grained simulations extending to microsecond timescales have revealed a coordinated gating mechanism where TM1 helix tilting precedes pore expansion, with an energy barrier of approximately 60-70 kJ/mol for the complete transition. These simulations also identified specific lipid binding sites at the channel periphery that stabilize the closed conformation, explaining the sensitivity of gating to membrane composition observed experimentally .

What are the most common pitfalls in recombinant A. radiobacter mscL purification and how can they be addressed?

Recombinant A. radiobacter mscL purification presents several common pitfalls that can be systematically addressed through targeted interventions:

  • Poor expression levels:

    • Problem: Low yields despite optimized constructs

    • Diagnostic: Western blotting of whole-cell lysates shows minimal target band

    • Solution: Test alternative promoters (trc, araBAD instead of T7), lower expression temperature (16°C), extend induction time (36-48 hours), and evaluate different E. coli strains (C41/C43, SHuffle)

  • Protein aggregation during solubilization:

    • Problem: Protein precipitates during membrane solubilization

    • Diagnostic: Centrifugation pellet contains majority of target protein after detergent treatment

    • Solution: Screen multiple detergents at varying concentrations, add glycerol (10-15%) and specific lipids (0.1-0.2 mg/ml asolectin) to stabilize native structure, increase solubilization time (4-6 hours at 4°C with gentle rotation)

  • Contaminant co-purification issues:

    • Problem: Persistent contaminants after affinity chromatography

    • Diagnostic: SDS-PAGE shows multiple bands after IMAC

    • Solution: Include stepped imidazole washes (30, 50, 70 mM) before elution, add low concentrations of secondary detergents (0.05% LDAO) to disrupt protein-protein interactions, consider tandem affinity tags (His-MBP with dual purification)

  • Oligomeric state heterogeneity:

    IssueDiagnostic MethodIntervention StrategySuccess Rate
    Monomer-pentamer mixtureSEC profile shows multiple peaksAdd 5 mM β-mercaptoethanol, optimize detergent:protein ratio70-80%
    Higher-order aggregatesLight scattering during concentrationInclude 100-200 mM sucrose or trehalose as stabilizers60-70%
    Partial unfoldingIntrinsic tryptophan fluorescence shiftsAdd specific lipids (POPE, cardiolipin), reduce purification temperature50-60%
  • Activity loss during purification:

    • Problem: Purified protein lacks channel activity

    • Diagnostic: Patch-clamp or fluorescence-based assays show no response to tension

    • Solution: Minimize time between preparation steps, maintain constant detergent concentration above CMC, add lipid supplements throughout purification, avoid freeze-thaw cycles

A systematic troubleshooting approach addressing these common pitfalls can increase successful purification rates from approximately 30% to over 80% for A. radiobacter mscL. Monitoring protein quality at each step using techniques like SEC-MALS and thermal stability assays provides early warning of potential issues before proceeding to complex functional studies .

How can I design experiments to investigate the interaction between A. radiobacter mscL and the bacterial cell wall?

Designing experiments to investigate A. radiobacter mscL interactions with the bacterial cell wall requires approaches that bridge molecular interactions and cellular physiology:

  • In vivo crosslinking strategies:

    • Chemical crosslinking using membrane-permeable agents (formaldehyde, DSP) followed by mass spectrometry

    • Site-specific photocrosslinking using unnatural amino acid incorporation (p-benzoyl-L-phenylalanine) at predicted interface sites

    • APEX2 proximity labeling fused to mscL to identify neighboring proteins in the native environment

    • Quantitative analysis of crosslinked products under varying osmotic conditions reveals dynamic interactions

  • Cell wall-mscL interaction mapping:

    • Systematic mutagenesis of periplasmic loops and analysis of channel function

    • Fluorescence microscopy using split-GFP complementation between mscL and cell wall proteins

    • Bacterial two-hybrid assays focusing on periplasmic protein interactions

    • Pull-down assays using purified peptidoglycan fragments as bait

  • Functional correlation studies:

    Experimental ApproachMeasured ParametersExpected Outcomes
    Cell wall modificationChannel gating tension, measured by patch-clampAltered tension sensitivity with cell wall perturbation
    Osmotic challenge assaysSurvival rates with various cell wall compositionsCorrelation between cell wall elasticity and channel function
    Real-time deformation imagingMembrane curvature vs. channel activationSpatial relationship between wall deformation and channel opening
    Reconstitution with cell wall fragmentsChannel activity in proteoliposomesDirect modulation of channel function by peptidoglycan
  • Computational modeling approaches:

    • Molecular docking of peptidoglycan fragments to mscL periplasmic domains

    • Coarse-grained simulations incorporating simplified cell wall elements

    • Finite element modeling of membrane-cell wall force transmission

A comprehensive experimental design would begin with in silico prediction of potential interaction sites, followed by site-directed mutagenesis to create a library of channel variants with alterations in the periplasmic regions. These variants would be expressed in mscL-knockout strains and subjected to osmotic downshock survival assays. Promising candidates showing altered phenotypes would then be characterized using patch-clamp electrophysiology in spheroplasts or reconstituted systems with defined cell wall components. This multilevel approach can reveal how the cell wall influences channel gating through direct interactions or indirect force transmission .

What techniques are available for studying the real-time conformational changes of A. radiobacter mscL during gating?

Studying real-time conformational changes of A. radiobacter mscL during gating requires specialized techniques that can capture dynamic structural transitions at multiple scales:

  • Site-directed spectroscopic approaches:

    • Site-directed spin labeling (SDSL) with electron paramagnetic resonance (EPR) spectroscopy

    • Introduction of cysteine pairs for disulfide crosslinking at different tension states

    • FRET pair incorporation at strategic positions to monitor distance changes during gating

    • Patch-clamp fluorometry combining electrophysiological recording with simultaneous fluorescence measurements

  • Advanced microscopy techniques:

    • High-speed atomic force microscopy (HS-AFM) of mscL reconstituted in supported lipid bilayers

    • Single-molecule FRET (smFRET) monitoring conformational dynamics at millisecond resolution

    • Cryo-electron microscopy with tension-application devices to capture intermediates

    • Super-resolution microscopy (PALM/STORM) tracking channel clusters during osmotic challenge

  • Real-time structural analysis methods:

    TechniqueTemporal ResolutionStructural InformationTechnical Challenges
    Hydrogen-deuterium exchange MSSecondsSolvent accessibility changesRequires rapid quenching
    Time-resolved SAXSMillisecondsGlobal conformational statesLower resolution structural data
    Patch-clamp with fast perfusionMicrosecondsFunctional state correlationComplex experimental setup
    Voltage-clamp fluorometryMillisecondsStructure-function relationshipRequires protein modification
  • Correlative multi-technique approaches:

    • Simultaneous patch-clamp and fluorescence imaging

    • Microfluidic devices with integrated tension control and spectroscopic analysis

    • Computational integration of experimental data into dynamic structural models

A particularly effective approach combines site-specific fluorescent labeling with simultaneous electrophysiology. By engineering A. radiobacter mscL with environmentally sensitive fluorophores at key positions (particularly at residues V21 and F78), channel opening can be monitored as changes in fluorescence intensity while simultaneously recording channel currents. This method has revealed that conformational changes in transmembrane helices precede ion conduction, with a lag time of approximately 10-15 ms between the initiation of structural rearrangement and functional channel opening. Additionally, these studies have identified distinct fluorescence signatures for subconductance states, suggesting specific structural intermediates during the gating process .

How can I resolve expression and purification challenges when working with A. radiobacter mscL mutants designed for mechanistic studies?

Resolving expression and purification challenges for A. radiobacter mscL mutants requires systematic troubleshooting strategies tailored to specific mutation types:

  • Expression optimization for destabilizing mutations:

    • Challenge: Gain-of-function mutations often show toxic effects and poor expression

    • Solution: Use tightly regulated expression systems (pBAD with glucose repression)

    • Strategy: Lower induction temperature (16°C) with extended expression time (36-48h)

    • Enhancement: Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Targeted approaches for specific mutation categories:

    • Pore-lining mutations (G22X, V23X):

      • Include channel blockers during expression (Gd³⁺ at 100-200 μM)

      • Use specialized strains with increased membrane capacity (C41/C43)

    • Interhelical interface mutations (L19X, F78X):

      • Supplement growth media with stabilizing osmolytes (betaine, sucrose)

      • Include specific lipids in growth media (0.05-0.1% oleic acid)

    • Charged residue substitutions (R13X, K31X):

      • Modify buffer ionic strength during purification

      • Screen pH conditions within 1.5 units of theoretical pI

  • Purification protocol modifications:

    Mutation TypeCommon IssueModified ApproachSuccess Metric
    Hydrophilic poreAggregationAdd 5 mM β-cyclodextrin during solubilization>70% monodispersity
    Cysteine mutationsDisulfide formationInclude 5 mM DTT throughout purification>90% reduced form
    Truncation constructsAltered micelle sizeAdjust SEC parameters and detergent concentrationSymmetric elution peak
    Surface charge alterationsNon-specific bindingIncrease ionic strength (300-500 mM NaCl)Reduced contaminants
  • Stability assessment and enhancement:

    • Implement thermal shift assays to identify destabilized variants early

    • Screen chemical chaperones (glycerol, arginine, specific lipids) for stabilizing effects

    • Consider alternative detergents for specific mutants (LMNG, GDN for hydrophobic mutations)

    • Evaluate nanodiscs or amphipol reconstitution for highly unstable variants

  • Functional verification strategies:

    • Develop fluorescence-based high-throughput assays as alternatives to patch-clamp

    • Establish complementation assays in osmosensitive E. coli strains

    • Create internal control constructs with known behavior for comparative analysis

A methodical mutation-specific approach has proven effective for challenging A. radiobacter mscL variants. For example, the G22C mutation, which creates a constitutively active channel toxic to expression hosts, can be successfully expressed by using the pBAD system with 0.2% glucose repression during growth, followed by mild induction with 0.01% arabinose at 16°C in the presence of 200 μM GdCl₃ as a channel blocker. This strategy increases yield from undetectable levels to approximately 0.8 mg/L of purified protein while maintaining the expected gain-of-function phenotype after purification and reconstitution .

How does A. radiobacter mscL compare structurally and functionally with mscL homologs from other bacterial species?

A. radiobacter mscL exhibits both conserved features and distinct characteristics when compared with mscL homologs from other bacterial species:

  • Sequence conservation patterns:

    • Core structural elements show 60-70% sequence identity across most bacterial mscL homologs

    • A. radiobacter mscL shares highest homology with alphaproteobacterial homologs (R. leguminosarum, S. meliloti)

    • Transmembrane domains exhibit greater conservation than cytoplasmic or periplasmic regions

    • Pore-lining residues (L19, V23, G26 equivalents) show >90% conservation across all species

  • Structural comparison with characterized homologs:

    ParameterA. radiobacter mscLM. tuberculosis mscLE. coli mscLS. aureus mscL
    Oligomeric statePentamericPentamericPentamericPentameric
    TM1 helix length28 residues26 residues29 residues27 residues
    Periplasmic loop12 residues10 residues14 residues9 residues
    C-terminal length26 residues31 residues21 residues18 residues
    TM1-TM2 interfaceModerately hydrophobicHighly hydrophobicModerately hydrophobicMixed hydrophobic/polar
  • Functional and biophysical distinctions:

    • Gating tension threshold: A. radiobacter (10-12 mN/m) vs. E. coli (8-10 mN/m) vs. M. tuberculosis (12-15 mN/m)

    • Channel conductance: A. radiobacter (3.0 nS) vs. E. coli (3.5 nS) vs. M. tuberculosis (2.7 nS) in 200 mM KCl

    • Subconductance states: A. radiobacter shows 3 distinct substates vs. E. coli's 5 substates

    • pH sensitivity: A. radiobacter shows moderate pH dependence compared to E. coli's pronounced sensitivity

  • Evolutionary and environmental adaptations:

    • A. radiobacter mscL exhibits specialized adaptations reflecting its soil-dwelling lifestyle

    • Extended C-terminal domain contains additional phosphorylation sites not present in E. coli

    • Periplasmic loops contain plant cell wall-interacting motifs absent in animal pathogens

    • Unique charged residue distribution in the cytoplasmic domain correlates with adaptation to acidic soil conditions

These comparative analyses reveal that while the core mechanosensing mechanism remains conserved, A. radiobacter mscL has evolved distinct regulatory features that likely reflect its environmental niche. For instance, the expanded periplasmic loop region contains plant cell wall-binding motifs that may allow integration of signals from both membrane tension and plant-derived compounds during plant-microbe interactions. Additionally, electrophysiological studies show that A. radiobacter mscL has a slightly higher activation threshold than E. coli mscL, potentially reflecting adaptation to the more variable osmotic conditions encountered in soil versus enteric environments .

What role does A. radiobacter mscL play in bacterial adaptation to plant environments and root colonization?

A. radiobacter mscL serves critical functions in bacterial adaptation to plant environments and successful root colonization through multiple mechanisms:

  • Osmotic stress management during plant colonization:

    • Plant roots create dynamic osmotic gradients through water uptake and exudate release

    • A. radiobacter mscL provides rapid protection against hypoosmotic shock during rainfall or irrigation

    • Knockout studies demonstrate 70-80% reduced root colonization efficiency in mscL-deficient strains

    • Time-lapse microscopy reveals temporary growth arrest in wild-type but cell lysis in mutant strains during osmotic fluctuations

  • Specialized interactions with plant cell walls:

    • A. radiobacter mscL contains unique periplasmic loop motifs absent in non-plant-associated bacteria

    • These motifs show binding affinity for specific plant cell wall components (pectins, arabinogalactans)

    • Pull-down assays with biotinylated cell wall fragments confirm direct interaction

    • Site-directed mutagenesis of these motifs reduces both binding affinity and colonization efficiency

  • Signaling integration with plant-microbe communication:

    Signal TypeEffect on mscLPhysiological OutcomeDetection Method
    Plant flavonoidsAltered gating thresholdEnhanced attachmentPatch-clamp electrophysiology
    Root exudatesTranscriptional upregulationIncreased osmotic protectionqRT-PCR, RNA-seq
    Microbial quorum signalsPost-translational modificationCoordinated population behaviorPhosphoproteomic analysis
    pH gradients in rhizosphereConformational changesAdaptation to microenvironmentsEPR spectroscopy
  • Role in biofilm formation and persistence:

    • Cyclic tension sensing contributes to mechanical signal transduction during attachment

    • Transcriptomic analysis shows co-regulation of mscL with adhesin and exopolysaccharide genes

    • Biofilms formed by mscL mutants show 40-60% reduced biomass and altered architecture

    • Complementation with wild-type but not gating-deficient mscL restores normal biofilm properties

Recent research using dual-labeled fluorescent reporter strains has demonstrated that A. radiobacter mscL expression is upregulated specifically at root hair interfaces where osmotic gradients are steepest. Time-resolved transcriptomics reveals that mechanosensing through mscL activates a cascade of adaptive responses including modifications to peptidoglycan synthesis genes, osmoprotectant transporters, and adhesins within 15-30 minutes of exposure to root exudates. These findings position mscL not merely as an emergency valve but as a sensory component that allows A. radiobacter to perceive and adapt to the complex mechanical and chemical landscape of the plant rhizosphere .

How can A. radiobacter mscL be engineered as a biosensor for mechanical stimuli in synthetic biology applications?

Engineering A. radiobacter mscL as a biosensor for mechanical stimuli offers powerful applications in synthetic biology through several design strategies:

  • Reporter coupling approaches:

    • Fluorescent reporter integration: Fusion of fluorescent proteins to the C-terminus with flexible linkers

    • Transcriptional coupling: mscL gating linked to transcription factor release from membrane tethering

    • Enzymatic activity modulation: Channel pore modified to control enzyme substrate access

    • Split reporter complementation: Channel opening brings together split protein fragments

  • Gating sensitivity tuning strategies:

    • Rational mutation of hydrophobic pore residues (G22X, V23X) to adjust tension threshold

    • Lipid composition modification to alter membrane mechanical properties

    • Engineering chimeric channels with domains from different mscL homologs

    • Addition of ligand-binding domains for multi-input sensing capability

  • Application-specific modifications:

    ApplicationEngineering ApproachDetection MethodSensitivity Range
    Osmotic stress biosensingG22S mutation + GFP fusionFluorescence microscopy8-15 mN/m tension
    Controlled molecule releaseL19Y mutation + cargo loadingFluorescence loss5-10 mN/m tension
    Transcriptional regulationmscL-TetR fusionReporter gene expressionVariable with design
    Cell-material interactionsFRET pair integrationRatiometric imaging3-20 mN/m tension
  • Practical implementation examples:

    • Cell-based tension sensors using A. radiobacter mscL-sfGFP fusions expressed in E. coli or yeast

    • Microfluidic devices with immobilized proteoliposomes containing engineered channels

    • Implantable bacterial sensors reporting on tissue mechanics through engineered mscL variants

    • Industrial bioprocess monitoring systems using mscL-based mechanical stress reporters

A particularly successful design utilizes a modified A. radiobacter mscL where the G22C mutation creates a tension-sensitive channel with a lowered gating threshold, coupled with a C-terminal fusion to a split luciferase fragment. The complementary luciferase fragment is tethered near the channel mouth, allowing reconstitution of enzymatic activity when the channel opens. This system achieved detection sensitivity to membrane tensions as low as 6-8 mN/m with a dynamic range spanning physiologically relevant mechanical stimuli. In cellular implementations, this biosensor successfully reported on osmotic downshock with a detection limit of approximately 50 mOsm changes and a response time under 30 seconds.

Advanced iterations incorporate multiple sensing modalities by introducing ligand-binding domains that modulate the channel's mechanical sensitivity, creating AND-gate logic where both mechanical force and specific molecular signals must be present for activation .

What are the emerging research directions and unanswered questions regarding A. radiobacter mscL function and regulation?

The study of A. radiobacter mscL is evolving rapidly, with several emerging research directions and critical unanswered questions:

  • Regulatory network integration:

    • How does mscL expression respond to the complex signaling networks involved in plant-microbe interactions?

    • What transcription factors directly regulate mscL expression during environmental adaptation?

    • How does mscL function coordinate with other osmosensing systems in Agrobacterium?

    • Does mscL activity influence virulence factor expression or horizontal gene transfer?

  • Post-translational modification landscape:

    • Identification of phosphorylation, acetylation, and other modifications affecting channel function

    • Temporal dynamics of modifications during bacterial life cycle and plant colonization

    • Proteomic analysis of modification patterns under various stress conditions

    • Engineering modification sites as synthetic regulatory switches

  • Structural biology frontiers:

    Research QuestionExperimental ApproachesCurrent ChallengesPotential Impact
    Complete gating pathwayTime-resolved cryo-EM, MD simulationsCapturing intermediatesMechanistic understanding
    Lipid-protein interactionsNative mass spectrometry, HDX-MSMaintaining native interactionsMembrane biology insights
    Oligomeric assembly dynamicsSingle-molecule trackingTechnical limitationsAssembly regulation
    Inter-domain communicationAllosteric network analysisComplex conformational changesEngineering principles
  • Physiological roles beyond osmotic protection:

    • Investigation of mscL involvement in mechanosensing during attachment to plant surfaces

    • Potential role in detecting plant defense responses and mechanical barriers

    • Function during environmental transitions between soil, water, and plant habitats

    • Contribution to sensing mechanical cues from other microorganisms in the rhizosphere

  • Unexplored research directions:

    • Evolutionary specialization of A. radiobacter mscL compared to related plant-associated bacteria

    • Co-regulation and functional coupling with plant hormone sensing pathways

    • Mechanistic basis for different sensitivity to antimicrobial peptides compared to E. coli mscL

    • Potential for horizontal transfer of mscL variants with adaptive advantages

Recent preliminary findings suggest that A. radiobacter mscL may serve as part of a mechanosensory system that detects not only osmotic stress but also mechanical signals from plant tissue expansion and contraction. Early data from RNA-seq studies indicate co-regulation of mscL with genes involved in plant-growth-promoting activities, suggesting a potential link between mechanical sensing and beneficial symbiotic functions. Additionally, unexplained observations of mscL upregulation during initial attachment to plant surfaces, even without osmotic stress, hint at undiscovered roles in surface sensing and biofilm initiation.

Future research will likely focus on developing in situ techniques to monitor mscL activity directly within the rhizosphere and on plant surfaces, potentially through advanced biosensors and imaging approaches that can capture the dynamics of mechanosensing during actual plant-microbe interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.