Recombinant Agrobacterium radiobacter UPF0283 membrane protein Arad_2632 (Arad_2632)

Shipped with Ice Packs
In Stock

Description

General Information

The Recombinant Full Length Agrobacterium radiobacter UPF0283 membrane protein Arad_2632 (Arad_2632) is a protein that, when fused to an N-terminal His tag and expressed in E. coli, has applications in various biological studies . The gene name for this protein is Arad_2632, with synonyms including Arad_2632 and UPF0283 membrane protein Arad_2632 .

Properties

The following table details the properties of Recombinant Full Length Agrobacterium radiobacter UPF0283 membrane protein Arad_2632 (Arad_2632) Protein, His-Tagged:

PropertyValue
SpeciesAgrobacterium radiobacter
SourceE. coli
TagHis
Protein LengthFull Length (1-362 amino acids)
FormLyophilized powder
AA SequenceMTKPTEDDPKGISRRPAAFSLEQEASREGAHTKTTAETPRRKPQSFDTEIVLTPDEEDPFLNPALTASDAEAAIAAPRRRRFSFGKVALSAFGILVSLAFGLWTDELIRNLFSRADWLGYTALTVLAIGILAVLAIVVRETAGMMRLAAVQTIKAEADAAVVETRPARAKALVQRLCTLL EANPATAKGRATLKAAEDDIIDAPHLIDLAERELLGPLDRSARVLILGASKRVSVVTAVSPRALVDILYVLYESAKLVRAMAELYGGRPGGLGMLKLMRDVLAHLAVTGSIAVGDSIVQQLIGHGLASKLSARLGEGVVNGMMTARIGIAAMDLCRPLSFKALKRPGIGDFVGDLAPNITGR
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge the vial before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
UniProt IDB9JFT7

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Arad_2632; UPF0283 membrane protein Arad_2632
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Agrobacterium radiobacter (strain K84 / ATCC BAA-868)
Target Names
Arad_2632
Target Protein Sequence
MTKPTEDDPKGISRRPAAFSLEQEASREGAHTKTTAETPRRKPQSFDTEIVLTPDEEDPF LNPALTASDAEAAIAAPRRRRFSFGKVALSAFGILVSLAFGLWTDELIRNLFSRADWLGY TALTVLAIGILAVLAIVVRETAGMMRLAAVQTIKAEADAAVVETRPARAKALVQRLCTLL EANPATAKGRATLKAAEDDIIDAPHLIDLAERELLGPLDRSARVLILGASKRVSVVTAVS PRALVDILYVLYESAKLVRAMAELYGGRPGGLGMLKLMRDVLAHLAVTGSIAVGDSIVQQ LIGHGLASKLSARLGEGVVNGMMTARIGIAAMDLCRPLSFKALKRPGIGDFVGDLAPNIT GR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Arad_2632 protein and how is it classified?

Arad_2632 is an uncharacterized membrane protein (UPF0283 family) found in Agrobacterium radiobacter. As a membrane protein, it likely plays a role in cellular transport or signaling, similar to other membrane proteins in A. radiobacter such as the fructose-binding protein (FBP) that facilitates sugar transport. The UPF designation (Uncharacterized Protein Family) indicates that while the protein has been identified through genomic analysis, its specific function remains undetermined. Research approaches should begin with bioinformatic analysis comparing Arad_2632 to characterized membrane proteins in related bacterial species .

What are the optimal conditions for culturing A. radiobacter for protein expression studies?

For optimal expression of membrane proteins in A. radiobacter, researchers should culture the bacteria at 28 ± 2°C in nutrient broth or nutrient agar (such as those from BD/Difco). Standard protocols involve inoculating a single colony into 10 mL of nutrient broth and incubating at 28 ± 2°C with shaking at 150 rpm for 24 hours. For continuous culture studies, a dilution rate (D) of approximately 0.045 h-1 has been successfully used in previous research with A. radiobacter . Carbon source selection significantly impacts protein expression patterns; fructose has been shown to induce higher expression of certain membrane transport proteins compared to glucose or succinate .

How can researchers distinguish between Arad_2632 and other membrane proteins in A. radiobacter?

Distinguishing Arad_2632 from other membrane proteins requires a multi-technique approach:

  • Immunological detection: Develop specific antibodies against Arad_2632 using recombinant protein expression and purification

  • Mass spectrometry: Employ LC-MS/MS for protein identification after membrane fractionation

  • Gene tagging: Introduce epitope tags or fluorescent proteins as fusion constructs

  • Knockout studies: Create deletion mutants and observe phenotypic changes

Researchers should note that A. radiobacter contains numerous membrane transport proteins, including the well-characterized fructose-binding protein (FBP) with a molecular weight of approximately 34-38 kDa (as determined by SDS-PAGE and gel-filtration FPLC) . Comparative analysis of protein characteristics can help distinguish Arad_2632 from these known proteins.

What expression systems are recommended for recombinant production of Arad_2632?

For recombinant expression of Arad_2632, researchers should consider these systems:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coli BL21(DE3)High yield, well-established protocolsPotential folding issues for membrane proteinsIPTG induction (0.1-1.0 mM), growth at 18-25°C after induction
A. radiobacter nativeNatural folding and processingLower yields, more complex manipulationHomologous recombination for chromosomal integration, native promoter
Pichia pastorisEukaryotic folding machinery, good for membrane proteinsLonger development timeMethanol induction, 72-96h expression
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldsSupplementation with lipids or detergents

When expressing membrane proteins from A. radiobacter, researchers should be mindful that growth conditions significantly influence expression levels. Previous studies with A. radiobacter membrane proteins showed that carbon source selection strongly affects protein expression, with fructose being a powerful inducer for certain membrane-associated proteins .

What purification strategies are most effective for isolating Arad_2632?

Purification of Arad_2632 should follow a strategic workflow:

  • Membrane fraction isolation: Disrupt cells using methods such as osmotic shock, which has been effective for isolating membrane-associated proteins in A. radiobacter

  • Solubilization: Test multiple detergents (DDM, LMNG, or digitonin) at various concentrations (0.5-2%)

  • Chromatography: Employ anion-exchange fast protein liquid chromatography (FPLC), which has proven successful for purifying membrane proteins from A. radiobacter

  • Affinity purification: If using tagged constructs, employ appropriate affinity resins

  • Size exclusion: Final polishing step to achieve homogeneity

Researchers should monitor purification efficiency using both SDS-PAGE and functional assays. For A. radiobacter membrane proteins, anion-exchange FPLC has been particularly effective, as demonstrated in the purification of the fructose-binding protein (FBP) .

How can researchers assess the functional integrity of purified Arad_2632?

Functional integrity assessment should include:

  • Binding assays: If ligands are identified, equilibrium dialysis can determine binding constants (KD), following methods used for FBP in A. radiobacter (which showed KD values around 0.49 μM for fructose)

  • Circular dichroism: To verify secondary structure integrity

  • Size-exclusion chromatography: Monitor oligomeric state and aggregation

  • Thermal stability assays: Such as differential scanning fluorimetry

  • Reconstitution into liposomes: For transport or activity measurements

When assessing membrane protein functionality from A. radiobacter, researchers can adapt protocols used for related proteins. For instance, the FBP was shown to bind fructose stoichiometrically at 1.17 nmol per nmol of protein with high affinity, providing a methodological template for binding studies .

What bioinformatic approaches can help predict Arad_2632 function?

Advanced bioinformatic strategies include:

  • Structural prediction using AlphaFold2 or RoseTTAFold

  • Molecular dynamics simulations in membrane environments

  • Comparative genomics across related bacterial species

  • Gene neighborhood analysis to identify functional associations

  • Protein-protein interaction prediction

Researchers should pay special attention to N-terminal sequences, as these can provide valuable insights into protein function. For instance, the N-terminal sequence of the FBP in A. radiobacter (ADTSVCLI-) showed similarity to sugar-binding proteins from other bacterial species, which helped establish its functional classification .

How can CRISPR-Cas9 be applied to study Arad_2632 function in vivo?

CRISPR-Cas9 applications for studying Arad_2632 include:

  • Gene knockout: Create complete deletion mutants to observe phenotypic changes

  • Domain mutagenesis: Target specific functional domains for structure-function analysis

  • Promoter modulation: Adjust expression levels to study dosage effects

  • Reporter fusion: Tag the native gene to study localization and expression patterns

The genetic manipulation protocol should be optimized for A. radiobacter, taking into account its growth characteristics at 28°C and appropriate antibiotic selection markers. Researchers should monitor phenotypic changes in various growth conditions, particularly comparing different carbon sources like fructose, ribose, mannose, and glucose, which have been shown to differentially affect membrane protein expression in A. radiobacter .

What approaches can resolve contradictory experimental results regarding Arad_2632 function?

When facing contradictory results, researchers should systematically:

  • Verify protein identity and integrity through mass spectrometry

  • Test multiple experimental conditions varying temperature, pH, and ionic strength

  • Use complementary methodologies (e.g., both in vitro and in vivo approaches)

  • Employ statistical analysis to determine significance of observations

  • Consider strain-specific variations (as seen in A. radiobacter strain AR100, which showed altered membrane protein expression)

For example, if transport assays yield inconsistent results, researchers should consider that A. radiobacter membrane transport systems show variable inhibition by different compounds. Previous research demonstrated that transport systems in A. radiobacter are inhibited to varying extents by osmotic shock and by uncoupling agents like carbonyl cyanide p-trifluoromethoxyphenylhydrazone .

What are the most effective methods for determining Arad_2632 membrane topology?

Membrane topology determination should employ multiple complementary approaches:

  • Substituted cysteine accessibility method (SCAM)

  • PhoA/LacZ fusion analysis

  • Cryo-electron microscopy for structural determination

  • Protease protection assays

  • Fluorescence quenching experiments

These methods should be calibrated against known membrane proteins in A. radiobacter. Researchers can use the data from other characterized membrane proteins in this organism, such as the periplasmic fructose/mannose-binding-protein, as reference points for experimental design and interpretation .

How can researchers identify potential interaction partners of Arad_2632?

Interaction partner identification should utilize:

  • Co-immunoprecipitation with specific antibodies

  • Bacterial two-hybrid systems

  • Cross-linking coupled with mass spectrometry

  • Proximity labeling (BioID or APEX)

  • Co-purification studies followed by proteomics

When investigating membrane protein interactions in A. radiobacter, researchers should consider that many transport systems in this organism involve multiple components. The fructose transport system, for example, involves a periplasmic binding protein and likely additional membrane components for complete functionality .

What techniques are suitable for analyzing post-translational modifications of Arad_2632?

Post-translational modification analysis should include:

TechniqueTarget ModificationSample PreparationData Analysis Approach
PhosphoproteomicsPhosphorylationTiO₂ enrichmentSite localization algorithms
GlycoproteomicsGlycosylationLectin affinityGlycan composition determination
Mass spectrometryAll modificationsVarious enrichment strategiesDatabase-dependent and -independent search
Western blottingSpecific modificationsAntibody selectionQuantitative band analysis
2D gel electrophoresisMultiple modificationsIsoelectric focusingPattern recognition

Researchers should be aware that bacterial membrane proteins often undergo modifications that affect their localization and function. In A. radiobacter, protein expression and modification can be influenced by growth conditions and carbon source availability .

How does Arad_2632 compare to homologous proteins in related bacterial species?

Comparative analysis should focus on:

  • Sequence alignment across Rhizobiaceae family members

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural comparison with homologs of known function

  • Conservation analysis of key residues

  • Horizontal gene transfer detection

Researchers should note that A. radiobacter is closely related to Agrobacterium tumefaciens and various Rhizobium species, which may contain homologous proteins. Previous research has shown immunological similarity between certain proteins in A. radiobacter and those in A. tumefaciens and Rhizobium species following growth on specific carbon sources like fructose .

What evolutionary insights can be gained from studying Arad_2632?

Evolutionary analysis should examine:

  • Selection pressure on different domains

  • Gene duplication events within the genome

  • Acquisition through horizontal gene transfer

  • Co-evolution with other cellular components

  • Adaptive changes in different environmental conditions

When investigating evolutionary aspects, researchers should consider that transport systems in A. radiobacter differ from those in many other bacterial species. For example, fructose transport in A. radiobacter occurs via a periplasmic binding-protein-dependent active-transport system, in contrast to the phosphotransferase system used by many other bacterial species .

How can knowledge about Arad_2632 contribute to understanding pathogenicity in related species?

Knowledge application to pathogenicity should explore:

  • Role in host-pathogen interactions

  • Contribution to virulence factors

  • Potential involvement in biofilm formation

  • Comparison with homologs in pathogenic strains

  • Expression changes during infection

This research is particularly relevant as related species like Rhizobium radiobacter (formerly Agrobacterium tumefaciens) cause crown gall disease in plants through mechanisms involving the tumor-inducing plasmid (pTi). Understanding membrane proteins may provide insights into bacterial adaptation during pathogenesis .

What are the best approaches for developing inhibitors or modulators of Arad_2632 function?

Inhibitor development strategies should include:

  • High-throughput screening of compound libraries

  • Structure-based drug design if structural data is available

  • Fragment-based drug discovery

  • Computational docking and virtual screening

  • Peptidomimetic design targeting interaction interfaces

For validation, researchers can adapt methods used to study inhibition of other transport systems in A. radiobacter. Previous research demonstrated that transport systems can be inhibited by various compounds with differential specificity. For example, fructose transport was inhibited by unlabelled sugars with varying effectiveness (D-fructose/D-mannose > D-ribose > D-sorbose > D-glucose/D-galactose/D-xylose) .

How can researchers overcome difficulties in expressing sufficient quantities of Arad_2632?

To improve expression yields, researchers should consider:

  • Codon optimization for the expression system

  • Use of fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Testing various induction conditions (temperature, inducer concentration, time)

  • Specialized expression strains designed for membrane proteins

  • Co-expression with chaperones

When optimizing expression of A. radiobacter membrane proteins, researchers should note that prolonged growth in specific conditions (such as fructose-limited continuous culture) can lead to the selection of strains with altered expression profiles, as demonstrated by strain AR100 which overproduced a fructose-binding protein .

What strategies can address protein instability during purification and characterization?

Stability enhancement approaches include:

  • Screening multiple detergents and buffer conditions

  • Addition of specific lipids or cholesterol

  • Use of styrene-maleic acid lipid particles (SMALPs)

  • Nanodiscs or amphipols as detergent alternatives

  • Addition of ligands or binding partners during purification

For A. radiobacter membrane proteins, researchers should consider that specific buffer components and handling techniques significantly impact stability. Successful purification of membrane-associated proteins from A. radiobacter has been achieved using osmotic shock fluid as a starting material, followed by anion-exchange fast protein liquid chromatography (FPLC) .

How can single-molecule techniques advance our understanding of Arad_2632 function?

Single-molecule approaches to consider include:

  • Single-molecule FRET to measure conformational changes

  • Optical tweezers to assess mechanical properties

  • Single-molecule localization microscopy for distribution studies

  • Patch-clamp electrophysiology if channel activity is suspected

  • Atomic force microscopy for topographical and force measurements

These techniques can provide insights into dynamic properties not accessible through bulk measurements, potentially revealing mechanistic details of how Arad_2632 functions within the membrane environment.

What are the implications of Arad_2632 research for synthetic biology applications?

Synthetic biology applications to explore include:

  • Engineering modified versions with enhanced or altered functions

  • Incorporating the protein into synthetic cellular systems

  • Developing biosensors based on Arad_2632 binding properties

  • Creating chimeric proteins with novel functionalities

  • Designing minimal systems for specific transport functions

Researchers can draw inspiration from the natural adaptation seen in A. radiobacter strains. For example, the development of strain AR100, which overproduced a fructose-binding protein after prolonged growth in fructose-limited conditions, demonstrates how selective pressure can modify protein expression patterns .

What are the most promising directions for future research on Arad_2632?

Priority research areas should include:

  • Comprehensive structural determination using cryo-electron microscopy

  • Functional characterization through in vivo studies

  • Integration with systems biology approaches

  • Comparative analysis across bacterial species

  • Development of specific inhibitors or modulators

Research on Arad_2632 should be integrated with broader studies of membrane transport systems in A. radiobacter, considering that this organism utilizes unique transport mechanisms compared to many other bacterial species .

How can collaborative approaches accelerate progress in understanding Arad_2632?

Effective collaboration strategies include:

  • Development of standardized protocols for expression and purification

  • Creation of shared resources and materials

  • Establishment of dedicated research consortia

  • Integration of computational and experimental approaches

  • Cross-disciplinary projects involving structural biologists, microbiologists, and biochemists

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.