Recombinant Agrobacterium fabrum Aquaporin Z 2 (aqpZ2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

FeatureDetail
Gene IDKEGG: atu:Atu0476; STRING: 176299.Atu0476
Protein LengthFull-length (1–232 amino acids)
Molecular WeightNot explicitly reported; inferred from sequence (~25–30 kDa)
Expression SystemE. coli (in vitro)
Purification TagN-terminal His-tag

Comparative Analysis with Homologs

FeatureaqpZ2 (Agrobacterium fabrum)aqpZ1 (Sinorhizobium meliloti)E. coli AqpZ**
Sequence Similarity82.5% (with S. meliloti aqpZ1) 60–70% (estimated)
Expression ContextRecombinant protein Native/RecombinantNative/Recombinant (membrane)
Functional StudiesLimitedChemotaxis, osmoadaptation Water permeability assays

Applications and Research Potential

Recombinant aqpZ2 is used to study:

  1. Water Transport Mechanisms: Membrane reconstitution assays to measure water flux .

  2. Structural Biology: Crystallization trials for atomic-resolution structures (modeled after E. coli AqpZ) .

  3. Biotechnology: Potential in bioremediation or synthetic biology for osmotic stress tolerance .

Challenges and Future Directions

  • Limited Functional Data: Most insights derive from homologs; targeted mutagenesis and electrophysiology studies are needed.

  • Expression Efficiency: Optimization of E. coli systems to improve yield, as inclusion body formation is common in aquaporins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To prioritize a specific tag, please specify your requirements in advance.
Synonyms
aqpZ2; Atu5361; AGR_pAT_521; Aquaporin Z 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
aqpZ2
Target Protein Sequence
MGRKLLAEFFGTFWLVFGGCGSAVFAAAFPELGIGFTGVALAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGRFPASSLVPYVIAQVAGAIVAAAALYVIATGKAGIDLGGFASNGYGEHSPGGYSLVSALLIEIILTAFFLIVILGSTHGRVPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPIVGGAAGAVIWKLFGEKD
Uniprot No.

Target Background

Function

Aquaporin Z2 (aqpZ2) is a channel protein that facilitates the osmotically driven bidirectional movement of water. It plays a crucial role in osmoregulation and maintaining cell turgor during volume expansion in rapidly growing cells. AqpZ2 mediates the rapid influx or efflux of water in response to changes in osmolarity.

Database Links

KEGG: atu:Atu5361

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium fabrum Aquaporin Z 2 (aqpZ2)?

Agrobacterium fabrum Aquaporin Z 2 (aqpZ2) is a transmembrane protein belonging to the MIP/aquaporin (TC 1.A.8) family. It functions as a channel that permits osmotically driven movement of water in both directions across cell membranes. The protein is involved in osmoregulation and maintenance of cell turgor during volume expansion in rapidly growing cells, mediating rapid entry or exit of water in response to abrupt changes in osmolarity . The full-length protein consists of 232 amino acids with the UniProt identification number Q8UJW4 .

How are recombinant aquaporins typically expressed?

Recombinant aquaporin expression strategies depend on the origin of the protein. For prokaryotic aquaporins like aqpZ2, Escherichia coli is generally the preferred expression host, while eukaryotic aquaporins are more commonly expressed in Pichia pastoris . The expression involves molecular cloning of the target gene into an appropriate vector with a fusion tag (commonly His-tag) to facilitate purification. For Agrobacterium fabrum aqpZ2, in vitro E. coli expression systems have been successfully employed . The expression conditions need to be optimized for temperature, induction duration, and inducer concentration to maximize protein yield while maintaining proper folding and functionality of the membrane protein.

What are the recommended storage conditions for recombinant aqpZ2?

For optimal stability, recombinant aqpZ2 should be stored according to its formulation. For lyophilized forms, storage at -20°C/-80°C provides a shelf life of approximately 12 months. For liquid formulations, the shelf life is typically 6 months at -20°C/-80°C . To prevent protein degradation during storage, it is advisable to aliquot the protein to avoid repeated freeze-thaw cycles. For working stocks, storage at 4°C for up to one week is generally acceptable . Buffer composition significantly impacts stability, with most aquaporin preparations being most stable in Tris/PBS-based buffers with 6% trehalose at pH 8.0 .

How does the structure of Agrobacterium fabrum aqpZ2 compare to other bacterial aquaporins?

Agrobacterium fabrum aqpZ2 shares significant structural homology with other bacterial aquaporins, particularly with Rhizobium meliloti aqpZ2 (Q92ZW9) and E. coli AqpZ. Comparative sequence analysis reveals conserved domains characteristic of the MIP/aquaporin family . The protein exhibits the typical hourglass fold with six transmembrane α-helices and two half-helices that form the water-selective channel. The NPA (Asparagine-Proline-Alanine) motifs, critical for water selectivity, are conserved in aqpZ2 as they are in other bacterial aquaporins.

What methodologies are effective for measuring aqpZ2 water permeability?

Measuring water permeability through aqpZ2 channels requires specialized techniques that can accurately quantify the rapid movement of water molecules. The following methodologies have proven effective:

  • Stopped-Flow Spectroscopy: This technique measures the kinetics of cell volume changes in response to osmotic gradients. Cells expressing aqpZ2 are equilibrated in solutions containing non-diffusible solutes (e.g., 1.4 mol/L sorbitol) followed by exposure to hyperosmotic shocks (typically Λ = 1.25, 350 mmol/L gradient) . The resulting changes in light scattering are monitored and fitted to theoretical curves to derive permeability values.

  • Proteoliposome Swelling Assays: Purified aqpZ2 is reconstituted into liposomes, and water permeability is assessed by monitoring the rate of liposome swelling upon exposure to a hypotonic environment.

  • Activation Energy Determination: By performing permeability measurements at different temperatures (typically 10-37°C), the activation energy (Ea) for water transport can be calculated using Arrhenius plots. Lower activation energy values indicate channel-mediated water transport rather than diffusion through the lipid bilayer .

For accurate permeability assessment, membrane surface tension should be kept to a minimum to maintain aquaporin activity at maximum levels .

How can researchers distinguish between water and glycerol permeability in aqpZ2?

Distinguishing between water and glycerol permeability in aqpZ2 requires specialized experimental approaches:

TechniqueWater PermeabilityGlycerol Permeability
Stopped-flow light scatteringInitial rate of cell volume change upon osmotic shockSlower phase of volume change in glycerol gradients
Isotope labelingH₂O¹⁸/H₂O¹⁶ exchange rateC¹³-labeled glycerol uptake
Computational modelingSimulated water molecule passageGlycerol molecule energy barriers

To experimentally differentiate these permeabilities, researchers can apply hyperosmotic shocks using either sorbitol (testing only water permeability) or glycerol (testing both water and glycerol permeability) . The resulting volume changes are fitted to theoretical curves that account for both water and glycerol fluxes and the resulting changes in cell volume and intracellular solute concentrations. This requires numerical integration using mathematical models implemented in software such as Berkeley Madonna .

What regulatory mechanisms control aqpZ2 function at the molecular level?

Regulation of aqpZ2 function occurs through multiple mechanisms:

  • pH Regulation: Similar to other aquaporins, aqpZ2 activity is modulated by pH changes, which can alter protein conformation and channel gating properties. Specific histidine residues act as pH sensors, with protonation states affecting channel permeability .

  • Phosphorylation: While less studied in bacterial aquaporins than their mammalian counterparts, potential phosphorylation sites exist in aqpZ2 that may modulate its activity. In mammalian aquaporins, kinases like PKA, PKC, and MAPK phosphorylate specific residues to control channel activity and membrane trafficking .

  • Membrane Tension: Mechanical forces affecting membrane tension can directly impact aqpZ2 function. Experimental protocols for assessing aquaporin function are designed to minimize membrane surface tension to maintain maximum channel activity .

  • Protein-Protein Interactions: Association with other membrane proteins or cytoskeletal elements may regulate aqpZ2 positioning and function within the bacterial membrane, though these interactions remain less characterized than for mammalian aquaporins.

What are the optimal conditions for expressing recombinant Agrobacterium fabrum aqpZ2?

Optimal expression of recombinant Agrobacterium fabrum aqpZ2 requires careful consideration of several experimental parameters:

ParameterOptimal ConditionNotes
Expression hostE. coli BL21(DE3)Preferred for prokaryotic aquaporins
Growth medium2xYT or Terrific BrothRicher media improve membrane protein yield
Temperature20-25°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGMild induction preferred for membrane proteins
Post-induction16-18 hoursExtended expression time at lower temperature
OD₆₀₀ at induction0.6-0.8Mid-log phase optimal for membrane protein expression

For optimal results, the expression construct should include a cleavable His-tag for purification purposes. The expression can be enhanced by co-expression with molecular chaperones or using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3) . Constant monitoring of cell density and proper aeration during growth are critical for high-quality protein production.

What purification strategy yields the highest purity and activity of aqpZ2?

A highly effective purification strategy for Agrobacterium fabrum aqpZ2 typically involves a two-step approach after proper solubilization:

  • Membrane Isolation and Solubilization:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Isolate membranes by ultracentrifugation (typically 100,000 × g for 1 hour)

    • Solubilize membranes using glucopyranoside detergents (e.g., n-dodecyl-β-D-maltoside at 1-2% w/v)

    • Incubate with gentle agitation at 4°C for 1-2 hours

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Load solubilized protein onto Ni-NTA resin

    • Wash with buffer containing low imidazole (20-40 mM) and 0.05-0.1% detergent

    • Elute with buffer containing high imidazole (250-500 mM)

  • Size Exclusion Chromatography (SEC):

    • Further purify IMAC eluate by SEC using Superdex 200 or similar

    • Collect fractions corresponding to tetrameric aqpZ2 (~100 kDa)

    • Verify purity by SDS-PAGE (>90% purity achievable)

Throughout the purification process, maintaining the detergent concentration above its critical micelle concentration is essential to prevent protein aggregation. The final purified protein can be stored in buffer containing 6% trehalose at pH 8.0, which enhances stability during storage .

How can researchers effectively reconstitute aqpZ2 into proteoliposomes for functional studies?

Reconstitution of aqpZ2 into proteoliposomes is a critical step for functional characterization. The following protocol yields consistently functional proteoliposomes:

  • Liposome Preparation:

    • Mix lipids (typically E. coli polar lipids or a defined mixture of POPC:POPE:POPG at 7:2:1 ratio) in chloroform

    • Evaporate solvent under nitrogen stream and vacuum dessication

    • Hydrate lipid film in buffer (typically PBS pH 7.4) to 10 mg/ml final concentration

    • Subject to freeze-thaw cycles (5-10 cycles) and extrusion through 400 nm membranes

  • Protein Incorporation:

    • Mix purified aqpZ2 with preformed liposomes at protein:lipid ratios of 1:50 to 1:200 (w/w)

    • Add detergent (e.g., Triton X-100) to destabilize liposomes (reaching onset of solubilization)

    • Incubate mixture at room temperature for 30 minutes with gentle agitation

    • Remove detergent using Bio-Beads SM-2 (three additions: 2 hours, 2 hours, and overnight at 4°C)

    • Collect proteoliposomes by ultracentrifugation (100,000 × g for 1 hour)

    • Resuspend in appropriate buffer for functional assays

  • Quality Control:

    • Verify protein incorporation by SDS-PAGE and Western blotting

    • Check vesicle size and homogeneity by dynamic light scattering

    • Assess protein orientation using protease protection assays

    • Confirm functionality using stopped-flow measurements as described in section 2.2

The success of reconstitution can be verified by freeze-fracture electron microscopy to visualize protein distribution within the lipid bilayer. Properly formed proteoliposomes should show enhanced water permeability compared to empty liposomes, with characteristic low activation energy values (typically <5 kcal/mol).

How should researchers analyze stopped-flow data to accurately determine aqpZ2 water permeability?

Analysis of stopped-flow data for determining aqpZ2 water permeability requires several critical steps:

  • Data Collection:

    • Record light scattering intensity (typically at 90°) from proteoliposomes or cells following an osmotic shock

    • Collect multiple traces (10-15) at each experimental condition

    • Perform measurements at multiple temperatures (10°C, 20°C, 30°C, 37°C) for activation energy determination

  • Data Processing:

    • Normalize each trace to initial light scattering intensity

    • Average multiple traces to reduce signal noise

    • Convert light scattering signals to relative volume changes (v<sub>rel</sub>)

  • Permeability Calculation:

    • Fit experimental curves to theoretical models using numerical integration

    • The osmotic water permeability coefficient (P<sub>f</sub>) can be derived from the equation:
      dVdt=Pf×S×Vw×Δosm\frac{dV}{dt} = P_f \times S \times V_w \times \Delta \textrm{osm}
      where V is vesicle volume, S is surface area, V<sub>w</sub> is the molar volume of water, and Δosm is the osmotic gradient

  • Software Implementation:

    • Use Berkeley Madonna or similar software for curve fitting and numerical integration of the water and glycerol fluxes

    • Compare fits with and without glycerol permeability to distinguish between water-only and water-glycerol permeability

  • Activation Energy Calculation:

    • Plot ln(P<sub>f</sub>) against 1/T (in Kelvin)

    • Calculate E<sub>a</sub> from the slope of the Arrhenius plot using:
      ln(Pf)=ln(A)EaRT\ln(P_f) = \ln(A) - \frac{E_a}{RT}
      where A is a constant, R is the gas constant, and T is temperature in Kelvin

Proper analysis should account for unstirred layer effects and include proper controls (empty liposomes or untransfected cells) to determine the contribution of aqpZ2 to the measured permeability .

What statistical approaches are appropriate for comparing aqpZ2 mutants and wild-type protein?

When comparing the functional properties of aqpZ2 mutants with the wild-type protein, appropriate statistical approaches are essential:

  • Experimental Design Considerations:

    • Include multiple biological replicates (minimum n=3, preferably n≥5)

    • Perform technical replicates for each biological sample

    • Include appropriate controls (empty vector, non-functional mutant)

    • Blind the experimenter to sample identity when possible

  • Statistical Tests:

    • For comparing two groups (e.g., wild-type vs. single mutant): Student's t-test (paired or unpaired)

    • For multiple comparisons (e.g., wild-type vs. multiple mutants): One-way ANOVA followed by post-hoc tests (Tukey's or Bonferroni)

    • For dose-response or temperature-response data: Two-way ANOVA

  • Data Presentation:

    • Report mean ± standard error of the mean (SEM) or standard deviation (SD)

    • Use scatter plots with individual data points in addition to bar graphs

    • Use consistent axes scales when comparing multiple mutants

    • Clearly indicate statistical significance levels (p values)

  • Advanced Analyses for Structure-Function Relationships:

    • Correlation analysis between biophysical parameters (e.g., side chain volume) and functional measurements

    • Principal component analysis for mutational datasets with multiple parameters

    • Hierarchical clustering to identify functionally similar mutants

When interpreting results, consider that changes in expression level can affect functional measurements. Therefore, normalize permeability values to protein expression levels determined by Western blotting or another quantitative method. Additionally, when reporting statistical significance, adjust for multiple comparisons when appropriate to avoid Type I errors.

What are common challenges in expressing functional aqpZ2 and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional aqpZ2:

ChallengePossible CausesSolutions
Low protein yieldPoor expression, protein degradationOptimize codon usage, lower induction temperature (16-20°C), add protease inhibitors
Inclusion body formationOverexpression, improper foldingReduce inducer concentration, use specialized strains (C41/C43), co-express chaperones
Loss of activity during purificationDetergent-induced denaturation, aggregationTest different detergents (DDM, LMNG), maintain detergent above CMC, add stabilizing agents
Poor membrane targetingSignal sequence issues, toxicityUse different fusion partners, employ inducible promoters with tight regulation
Aggregation during storageImproper buffer conditions, freeze-thaw damageAdd glycerol/trehalose (6%), aliquot to avoid freeze-thaw cycles, optimize pH and salt concentration

For particularly challenging cases, cell-free expression systems can be considered as an alternative approach. These systems bypass issues related to toxicity and membrane targeting by directly synthesizing the protein in the presence of supplied lipids or detergents .

How can researchers differentiate between properly folded and misfolded aqpZ2?

Several complementary methods can help distinguish properly folded functional aqpZ2 from misfolded protein:

  • Size Exclusion Chromatography (SEC):

    • Properly folded aqpZ2 typically elutes as a symmetrical peak corresponding to a tetrameric assembly

    • Misfolded protein shows heterogeneous elution profiles with significant void volume peaks

  • Circular Dichroism (CD) Spectroscopy:

    • Correctly folded aqpZ2 shows characteristic α-helical signatures in the far-UV spectrum

    • Quantitative analysis of secondary structure content should match theoretical predictions

  • Thermostability Assays:

    • Differential scanning calorimetry (DSC) to determine melting temperature (T<sub>m</sub>)

    • Thermal shift assays using environmentally sensitive fluorescent dyes

    • Properly folded protein typically exhibits cooperative unfolding transitions

  • Protease Resistance:

    • Limited proteolysis with trypsin or other proteases

    • Well-folded membrane proteins generally show greater resistance to proteolytic digestion than misfolded variants

  • Functional Assays:

    • Water permeability measurements in proteoliposomes or cells

    • Characteristic low activation energy (<5 kcal/mol) for water transport through properly folded channels

  • Detergent Compatibility Profile:

    • Systematic testing of protein stability in different detergents

    • Well-folded protein typically shows consistent behavior across a range of mild detergents

Combining multiple approaches provides the most reliable assessment of aqpZ2 folding status. When troubleshooting expression and purification, monitoring changes in these parameters can help identify steps where protein folding may be compromised.

What strategies can improve the crystallization of aqpZ2 for structural studies?

Successful crystallization of membrane proteins like aqpZ2 remains challenging but can be achieved with the following strategies:

  • Protein Engineering:

    • Create fusion constructs with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Truncate flexible termini based on secondary structure predictions

    • Introduce surface mutations to reduce conformational heterogeneity

    • Consider chimeric constructs with structurally characterized aquaporins

  • Sample Preparation:

    • Achieve highest possible purity (>95% by SDS-PAGE)

    • Ensure monodispersity by SEC and dynamic light scattering

    • Test detergent exchange and mixed detergent systems

    • Consider lipidic cubic phase (LCP) crystallization for membrane proteins

  • Crystallization Screening:

    • Use specialized membrane protein crystallization screens

    • Screen multiple detergents (DDM, LMNG, OG, CYMAL)

    • Vary protein concentration (5-15 mg/ml)

    • Test additives known to promote membrane protein crystallization (e.g., cholesterol, specific lipids)

  • Crystal Optimization:

    • Fine-tune precipitant concentration in small increments

    • Adjust pH in 0.1-0.2 unit steps around initial hits

    • Try additive screens for improving crystal quality

    • Optimize crystallization temperature (4°C, 20°C)

  • Alternative Approaches:

    • If traditional crystallization fails, consider:

      • Lipidic cubic phase crystallization

      • Bicelle crystallization

      • Crystal formation in meso

      • Cryo-electron microscopy for structure determination

Successful structures of bacterial aquaporins have generally been determined by X-ray crystallography following crystallization in detergent micelles or lipidic environments . For aqpZ2, screening with a combination of glucopyranoside detergents has shown promising results for crystal formation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.