Recombinant Agrobacterium tumefaciens ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Structure and Function of ATP Synthase in A. tumefaciens

ATP synthase in A. tumefaciens comprises two sectors:

  • F1: Catalytic head (α3β3γδε subunits) for ATP synthesis.

  • Fo: Membrane-embedded proton channel (ab2c10 subunits).

The α-subunit (atpA) forms part of the F1 hexamer, binding nucleotides and facilitating conformational changes during ATP synthesis . Recombinant atpA is produced to study its role in enzyme assembly and catalysis .

Recombinant Production and Applications

Recombinant atpA is commercially available as a partial protein (MyBioSource.com) . Key features include:

ParameterDescription
Source organismAgrobacterium tumefaciens
Expressed systemLikely E. coli (common for recombinant proteins)
ApplicationsEnzyme kinetics, antibody production, structural studies
Purity≥90% (typical for commercial recombinant proteins)
Molecular weight~55 kDa (predicted for partial sequence)

This tool enables studies on ATP synthase’s role in bacterial metabolism and pathogenicity, including A. tumefaciens’ T-DNA transfer system, which relies on VirB11 ATPase homologs .

Assembly Mechanisms and Chaperones

ATP synthase assembly requires chaperones like Atp11 and Atp12, which prevent misfolding of α- and β-subunits . Key findings:

  • Atp11: Binds β-subunits in mitochondria and chloroplasts, ensuring soluble intermediates .

  • Atp12: Stabilizes α-subunits in mitochondria .

In A. tumefaciens, homologs of these chaperones likely exist, given conserved ATP synthase structures across bacteria . For example:

  • VirB11 (a type IV secretion ATPase) self-assembles into homomultimers, requiring ATP binding for functional C-terminal interactions .

  • Dominant-negative VirB11 mutants disrupt T-DNA transfer by titrating native proteins .

Cross-Organism Insights

Studies in Arabidopsis and yeast reveal principles applicable to A. tumefaciens:

  • Knockdown effects: Depleting ATP synthase subunits (e.g., atp1 in Arabidopsis) reduces complex stability and ATP synthesis without affecting electron transport chain components .

  • PPR proteins: Custom RNA-binding proteins can selectively deplete mitochondrial atp1 mRNA, validating subunit-specific roles .

  • Operon organization: Chloroplast atp genes (e.g., atpB/E, atpI/H/F/A) require RNA-binding proteins (e.g., BFA2) for transcript stabilization and translation .

Research Gaps and Future Directions

  1. Structural resolution: No high-resolution structures of A. tumefaciens ATP synthase exist. Cryo-EM studies could clarify atpA’s role.

  2. Chaperone homology: Whether A. tumefaciens employs Atp11/Atp12-like chaperones remains unconfirmed .

  3. Pathogenicity link: ATP synthase’s contribution to A. tumefaciens virulence is underexplored compared to VirB systems .

Key Citations

  1. MyBioSource recombinant atpA product .

  2. Atp11/Atp12 chaperone roles in ATP synthase assembly .

  3. VirB11 ATPase self-assembly mechanisms in A. tumefaciens .

  4. ATP synthase depletion effects in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpB; Atu0714; AGR_C_1295; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
atpB
Target Protein Sequence
MANDPTHQFLVQPIIPIEIGGVDFSFTNASLFMVATVAAASGFLYFATSNRGLIPTRMQS VAEMSYEFIASMLREGAGKKGMVFFPFVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFAL ACLVIGTVIVYGFYKHGLHFFGIFAPSGVPKALLPLVASIEMISFLSRPISLSVRLFANM LAGHITLKVFAGFVASMGALGALGVGGAVLPLIMTVAMTALEFLVAFLQAYVFAVLTCMY LNDAVHGGH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: atu:Atu0714

STRING: 176299.Atu0714

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.