Recombinant Agrobacterium tumefaciens Beta- (1-->2)glucan export ATP-binding/permease protein NdvA

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Agrobacterium tumefaciens Beta-(1→2)glucan export ATP-binding/permease protein NdvA is a genetically engineered variant of the NdvA protein, a critical component in the synthesis and transport of cyclic beta-(1→2)glucans. These glucans are essential for bacterial attachment to plant cells during infection and symbiosis . The recombinant form is typically expressed in Escherichia coli for research applications, enabling studies on its structural and functional properties .

Structure and Sequence

The NdvA protein belongs to the ABC transporter superfamily and features two key domains:

  • Transmembrane domain (TMD): Forms a pore in the inner membrane for glucan transport.

  • ATP-binding domain (NBD): Generates energy via ATP hydrolysis to drive export .

Biological Function

NdvA plays a dual role in:

  1. Beta-(1→2)glucan synthesis: Collaborates with ChvB to produce cyclic glucans intracellularly .

  2. Glucan export: Transports glucans across the inner membrane via ATP hydrolysis, ensuring their periplasmic accumulation .

Functional Insights from Mutant Studies:

  • ChvA mutants (A. tumefaciens): Accumulate 3× more cytoplasmic glucans than wild-type strains, with no detectable periplasmic glucans .

  • NdvA mutants (Rhizobium meliloti): Fail to export glucans, leading to defective nodulation in plants .

Research Applications

Recombinant NdvA is utilized in:

  • Mechanistic studies of ABC transporter dynamics.

  • Protein-protein interaction assays to identify binding partners in glucan export.

  • Biotechnological optimization of bacterial adhesion in plant transformation systems .

Example Use Case:

In Agrobacterium-mediated plant transformation, modulating glucan export via NdvA homologs (e.g., ChvA) enhances bacterial attachment efficiency, directly impacting T-DNA delivery .

Production and Purification

The recombinant protein is produced in E. coli with the following specifications:

ParameterDetail
Expression VectorpET-based system
TagN-terminal His tag
Storage BufferTris/PBS, 6% trehalose, pH 8.0
StabilityStable at -80°C; avoid freeze-thaw cycles
Data sourced from .

Evolutionary and Functional Homology

NdvA shares significant homology with:

  • ChvA (A. tumefaciens): 67% sequence identity; both are essential for glucan export .

  • HlyB (E. coli): Structural similarity in ATP-binding domains, suggesting conserved export mechanisms .

Future Directions

Current research focuses on:

  • Engineering hyperactive NdvA variants to improve bacterial-host interactions in biotechnology .

  • Structural resolution of the TMD-NBD interface to inform drug design against pathogenic bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndvA; chvA; Atu2728; AGR_C_4944; Beta-(1-->2glucan export ATP-binding/permease protein NdvA; Attachment protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
ndvA
Target Protein Sequence
MTLFQVYTRALRYLTVHKWRVAVVVIANVILAAITIAEPVLFGRIIDAISSGTNVTPILI LWAGFGVFNTVAYVAVAREADRLAHGRRATLLTEAFGRIISMPLSWHHLRGTSNALHTLL RASETLFGLWLEFMRTHLATFVALVLLIPTAMAMDLRLSFVLIGLGIVYWFIGKWVMGRT KDGQASVEEHYHSVFAHVSDSISNVSVLHSYNRIEAETKALKSFTEKLLSAQYPVLDWWA FASALNRTASTVSMMIILVIGTVLVKNGELRVGDVIAFIGFANLLIGRLDQMRQFVTQIF EARAKLEDFFVLEDAVKEREEPGDARELSNVSGTVEFRNINFGFANTKQGVHDVSFTAKA GETVAIVGPTGAGKTTLINLLQRVYDPDSGQILIDGTDISTVTKNSLRNSIATVFQDAGL LNRSIRENIRLGRETATDAEVVEAAAAAAATDFIDSRINGYLTQVGERGNRLSGGERQRI AIARAILKNAPILVLDEATSALDVETEARVKAAVDALRKNRTTFIIAHRLSTVRDADLVL FLDQGRIIEKGTFDELTQRGGRFTSLLRTSGLLTEDEGQQPRPKAIAS
Uniprot No.

Target Background

Function
This protein is involved in β-(1→2)-glucan export, a crucial process for crown gall tumor formation. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy.
Database Links

KEGG: atu:Atu2728

STRING: 176299.Atu2728

Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NdvA protein and what is its biological significance?

The NdvA protein is a 67,100-dalton bacterial ATP-binding transport protein encoded by the ndvA locus in Agrobacterium tumefaciens and related bacteria. It is structurally and functionally homologous to the chvA locus protein and belongs to a family of bacterial ATP-binding export proteins, showing particular similarity to Escherichia coli HlyB (involved in hemolysin export) and the mdr gene product of mammalian cells .

The biological significance of NdvA lies in its critical role in exporting cyclic beta-(1-->2)glucan from bacterial cells. This extracellular polysaccharide is fundamentally important for normal plant-bacterial interactions, particularly in the context of symbiotic relationships and plant transformation processes . Mutation studies have demonstrated that ndvA mutants exhibit reduced motility and form abnormal (small, white, empty) nodules on host plant roots, underscoring the protein's importance in bacterial-plant interactions .

How does the NdvA protein function in Agrobacterium tumefaciens?

The NdvA protein functions as an ATP-binding export protein in A. tumefaciens, specifically involved in the transport of beta-(1-->2)glucan from the bacterial cell to the extracellular environment. The current understanding of its function is based on several key observations:

  • NdvA mutants retain an active 235,000-dalton membrane intermediate involved in beta-(1-->2)glucan synthesis but fail to export the polysaccharide to the extracellular space .

  • The protein contains structural domains characteristic of ATP-binding transport proteins, suggesting it utilizes ATP hydrolysis to power the export process .

  • The export function appears to be selective for beta-(1-->2)glucan molecules, indicating a specific recognition mechanism within the transport pathway .

In its functional state, NdvA likely forms part of a transmembrane complex that facilitates the recognition, binding, and translocation of beta-(1-->2)glucan molecules across the bacterial cell membrane, with the process energetically driven by ATP hydrolysis.

What are the structural characteristics of the NdvA protein?

The NdvA protein is encoded by a single large open reading frame in the ndvA locus, producing a 67,100-dalton protein . While the detailed three-dimensional structure has not been fully elucidated in the provided research, comparative analyses with homologous proteins reveal several key structural features:

  • ATP-binding domains: As a member of the ATP-binding transport protein family, NdvA contains conserved nucleotide-binding domains characteristic of this protein class .

  • Transmembrane domains: Like other bacterial exporters, NdvA likely contains multiple transmembrane segments that form a channel or pore through which the beta-(1-->2)glucan substrate is transported .

  • Substrate recognition domains: Specific regions of the protein are presumed to be involved in the selective recognition of beta-(1-->2)glucan molecules, distinguishing them from other cellular polysaccharides .

The structural homology with E. coli HlyB suggests that NdvA may share similar domain organization and mechanistic features with this well-studied bacterial exporter .

How should researchers design experiments to study NdvA protein function in Agrobacterium tumefaciens?

When designing experiments to study NdvA protein function, researchers should adopt a multifaceted approach that combines genetic, biochemical, and cellular analyses:

Genetic Approaches:

  • Generate precise gene knockouts or targeted mutations in the ndvA locus using CRISPR-Cas9 or traditional homologous recombination techniques

  • Create complementation strains by introducing wildtype or modified ndvA genes into mutant backgrounds

  • Develop reporter gene fusions to monitor ndvA expression under various conditions

Biochemical Approaches:

  • Express and purify recombinant NdvA protein for in vitro functional studies

  • Establish ATP-binding and hydrolysis assays to evaluate the energetic aspects of transport

  • Develop beta-(1-->2)glucan transport assays using membrane vesicles or reconstituted proteoliposomes

Cellular/Phenotypic Approaches:

  • Quantify beta-(1-->2)glucan accumulation in cellular compartments versus extracellular space

  • Assess bacterial motility, attachment to plant cells, and nodule formation capabilities

  • Examine plant responses to infection with wildtype versus ndvA mutant strains

When designing these experiments, it is crucial to include appropriate controls, such as testing the bacterial ATP-binding intermediate (235,000-dalton protein) to ensure it remains active in your experimental system 3. As demonstrated by effective experimental design principles, researchers should isolate variables and use statistical methods like ANOVA to analyze results3.

What are the optimal conditions for expressing recombinant NdvA protein?

The optimal conditions for expressing recombinant NdvA protein depend on the expression system and the intended downstream applications. Based on general principles for membrane protein expression and the specific characteristics of NdvA:

Expression Systems:

  • Bacterial systems (E. coli): Consider using specialized strains designed for membrane protein expression (C41, C43, or Lemo21)

  • Yeast systems (P. pastoris): Particularly useful if bacterial expression results in toxicity or inclusion body formation

  • Cell-free systems: May be valuable for initial expression trials and functional studies

Expression Conditions:

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Induction: Mild induction conditions with lower concentrations of inducers

  • Media supplementation: Consider supplementing with specific lipids that may facilitate membrane insertion

Purification Considerations:

  • Detergent selection: Test a panel of detergents for optimal solubilization while maintaining protein function

  • Affinity tags: Position tags (His, FLAG, etc.) to minimize interference with transport function

  • Buffer conditions: Optimize salt concentration, pH, and glycerol content for stability

Since NdvA is an ATP-binding protein involved in transport, it is crucial to verify that the recombinant protein retains its ATP-binding capability and substrate recognition functions after expression and purification .

What analytical methods are most effective for studying NdvA-mediated beta-(1-->2)glucan export?

Several analytical methods are particularly effective for studying NdvA-mediated beta-(1-->2)glucan export:

Quantitative Export Assays:

  • Radiolabeled substrate tracking: Using 14C-labeled glucose to track the synthesis and export of beta-(1-->2)glucan

  • Fluorescently labeled glucan analysis: Utilizing fluorescent derivatives to visualize export in real-time

  • ELISA-based detection: Developing antibodies specific to beta-(1-->2)glucan for quantitative measurement

Functional Transport Studies:

  • Inside-out membrane vesicles: Preparing bacterial membrane vesicles to study ATP-dependent transport in vitro

  • Reconstituted proteoliposomes: Incorporating purified NdvA into artificial liposomes for transport studies

  • Permeabilized cell assays: Using selective permeabilization to study export in semi-intact cells

Structural and Interaction Studies:

  • Cryo-electron microscopy: Visualizing the NdvA transport complex in different conformational states

  • Surface plasmon resonance: Measuring binding kinetics between NdvA and beta-(1-->2)glucan substrates

  • Cross-linking studies: Identifying protein-protein interactions within the transport complex

For rigorous experimental design, researchers should employ appropriate statistical analyses like ANOVA to interpret results from multiple experimental conditions3. The methods should be carefully selected based on the specific research question, with consideration of controls that can distinguish between active transport and passive diffusion processes.

How does NdvA interact with other proteins in the beta-(1-->2)glucan synthesis and export pathway?

The interaction of NdvA with other proteins in the beta-(1-->2)glucan synthesis and export pathway represents a complex research area. Current evidence suggests a coordinated protein network:

Synthesis-Export Coupling:
NdvA likely interacts with the 235,000-dalton membrane intermediate protein involved in beta-(1-->2)glucan synthesis. This interaction is critical because ndvA mutants retain this active synthesis protein but fail to export the polysaccharide, indicating a handoff mechanism between synthesis and export machinery .

Potential Interaction Partners:

  • Synthesis complex components: Proteins involved in the polymerization of beta-(1-->2)glucan

  • Membrane scaffold proteins: May facilitate the organization of synthesis and export proteins into functional complexes

  • Regulatory proteins: Likely modulate the activity of the export complex in response to environmental signals

Research Approaches to Study These Interactions:

  • Bacterial two-hybrid or split-ubiquitin assays to screen for protein-protein interactions

  • Co-immunoprecipitation studies with tagged versions of NdvA

  • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to NdvA in vivo

  • Super-resolution microscopy to visualize the spatial organization of the synthesis-export complex

The interaction network likely extends to regulatory proteins that coordinate beta-(1-->2)glucan production with other cellular processes and environmental sensing, particularly in the context of plant-bacterial interactions .

What is the relationship between NdvA function and Agrobacterium virulence?

The relationship between NdvA function and Agrobacterium virulence involves complex bacterial-plant interactions that affect the transformation process:

Contribution to Virulence:

Plant Response Modulation:
Research has demonstrated that plants rapidly respond to Agrobacterium infection with changes in gene expression. From 16,000 cDNA fragments analyzed, 251 (1.6%) were differentially regulated 48 hours after co-cultivation with Agrobacterium . This response includes both general bacterial response elements and Agrobacterium-specific features.

The plant defense response to Agrobacterium involves the regulation of genes associated with signal perception, transduction, and defense mechanisms . The proper functioning of NdvA and subsequent beta-(1-->2)glucan export may influence this plant response, potentially suppressing certain defense mechanisms while activating others that facilitate transformation.

Interestingly, a nodulin-like gene was found to be regulated only by Agrobacterium (not by non-pathogenic bacteria like E. coli), suggesting specific recognition mechanisms that may involve bacterial surface components like beta-(1-->2)glucan .

How do mutations in specific domains of NdvA affect its export function?

Mutations in specific domains of NdvA can have distinct effects on its export function, providing insights into structure-function relationships:

ATP-Binding Domain Mutations:
Mutations in the conserved ATP-binding domain (e.g., Walker A and B motifs) would likely abolish the protein's ability to hydrolyze ATP, thereby preventing the energy-dependent transport of beta-(1-->2)glucan. Such mutations would be expected to phenocopy complete ndvA knockout mutants, displaying defects in beta-(1-->2)glucan export while retaining normal synthesis activity .

Transmembrane Domain Mutations:
Alterations in the transmembrane segments could disrupt:

  • Proper membrane insertion and folding

  • Formation of the transport channel

  • Conformational changes necessary for the transport cycle

These mutations might result in varied phenotypes, from complete loss of function to subtle changes in transport efficiency or substrate specificity.

Substrate Recognition Domain Mutations:
Mutations in regions involved in beta-(1-->2)glucan recognition could lead to:

  • Reduced affinity for the substrate

  • Altered specificity (potentially allowing export of structurally related molecules)

  • Disrupted coupling between substrate binding and ATP hydrolysis

Experimental Approaches to Study Domain-Specific Mutations:

  • Site-directed mutagenesis targeting conserved residues in each domain

  • Random mutagenesis followed by phenotypic screening

  • Suppressor mutation analysis to identify functional interactions between domains

  • Complementation studies with chimeric proteins (e.g., domains swapped with related transporters)

By systematically analyzing the effects of domain-specific mutations, researchers can develop a detailed model of the transport mechanism and potentially engineer variants with modified properties for biotechnological applications.

What statistical approaches are most appropriate for analyzing NdvA export activity data?

For Comparative Export Assays:

  • Analysis of Variance (ANOVA): Particularly useful when comparing export activity across multiple experimental conditions or mutant variants. One-way ANOVA can be used when examining a single factor's effect, while two-way ANOVA with replicates is appropriate when analyzing interactions between factors (e.g., mutation type and environmental conditions)3.

  • Post-hoc tests: Following ANOVA, tests such as Tukey's HSD should be employed to determine specific differences between groups when more than two conditions are being compared3.

  • Student's t-test: Appropriate for direct comparison between two conditions (e.g., wild-type versus a specific mutant) when analyzing a single dependent variable.

For Time-Course Export Data:

  • Repeated measures ANOVA: Suitable for analyzing export activity measured at multiple time points.

  • Regression analysis: Useful for modeling the relationship between export activity and time or substrate concentration.

  • Area under the curve (AUC) analysis: Can provide a cumulative measure of export activity over time.

For Complex Datasets:

  • Principal Component Analysis (PCA): Helpful when analyzing multiple variables related to export function.

  • Hierarchical clustering: Can identify patterns among different mutants or experimental conditions.

  • Machine learning approaches: May reveal non-obvious relationships in complex datasets with multiple variables.

When reporting statistical results, following guidelines from experimental design literature is essential, including clearly stating the statistical test used, sample sizes, p-values, and confidence intervals3. Additionally, researchers should ensure data meets the assumptions of their chosen statistical tests (normality, homoscedasticity, etc.) and consider using non-parametric alternatives when these assumptions are violated.

How can researchers address data inconsistencies in NdvA functional studies?

Addressing data inconsistencies in NdvA functional studies requires a systematic approach to identify and resolve sources of variation:

Sources of Inconsistency and Resolution Strategies:

  • Experimental Variability:

    • Issue: Differences in bacterial growth conditions affecting protein expression

    • Solution: Standardize growth phases, media composition, and induction protocols

    • Validation: Verify consistent protein expression levels via Western blot before functional assays

  • Technical Variation:

    • Issue: Differences in membrane preparation affecting NdvA activity

    • Solution: Develop standardized protocols for membrane isolation and reconstitution

    • Validation: Include internal controls to normalize for preparation efficiency

  • Substrate Heterogeneity:

    • Issue: Variation in beta-(1-->2)glucan structure or purity

    • Solution: Use well-characterized, consistent substrate preparations

    • Validation: Analyze substrate composition before each experimental series

  • Interdependent Variables:

    • Issue: Unrecognized interactions between experimental factors

    • Solution: Employ full-factorial experimental designs to identify interactions3

    • Validation: Analyze interaction effects in statistical models

Analytical Approaches to Reconcile Inconsistencies:

When inconsistencies arise between in vitro and in vivo results, researchers should consider that such differences might reflect biological reality rather than experimental error. The complex cellular environment may introduce regulatory factors or physical constraints not present in simplified in vitro systems. In such cases, the goal should be to understand the basis for these differences rather than simply dismissing one set of results.

What are the best practices for comparing NdvA function across different Agrobacterium strains?

Comparing NdvA function across different Agrobacterium strains requires careful experimental design and standardized methodologies to ensure valid comparisons:

Standardization Considerations:

  • Genetic Background Control:

    • Generate isogenic strains differing only in ndvA alleles when possible

    • If using naturally different strains, consider complementation with a standard ndvA allele

    • Account for potential differences in gene regulation by measuring ndvA expression levels

  • Growth Standardization:

    • Ensure all strains are cultured under identical conditions

    • Normalize data to growth parameters (e.g., OD600, CFU/mL)

    • Consider growth phase effects by sampling at equivalent physiological states

  • Methodological Consistency:

    • Use identical protocols for all functional assays

    • Process all samples simultaneously when possible

    • Include internal standards across experimental batches

Comparative Analysis Framework:

Analysis LevelMeasurement ApproachNormalization MethodStatistical Analysis
Gene ExpressionRT-qPCR or RNA-SeqReference genes (e.g., 16S rRNA)ANOVA with post-hoc tests
Protein LevelWestern blot or targeted proteomicsTotal protein or housekeeping proteinsRatio analysis with confidence intervals
Export ActivityQuantitative beta-(1-->2)glucan assaysPer cell or per NdvA proteinTwo-way ANOVA with strain and condition as factors
Plant ResponseDefense gene expression or transformation efficiencyHousekeeping genes or mock inoculationMixed-effects models accounting for plant variation

Interpretation Considerations:

When interpreting cross-strain comparisons, researchers should consider evolutionary relationships between strains and potential adaptations to different ecological niches. Differences in NdvA function might reflect adaptive specialization rather than simple "better/worse" functionality.

Additionally, plant responses to different Agrobacterium strains may vary significantly. Research has shown that plant cells respond to Agrobacterium infection with differential regulation of genes involved in signal perception, transduction, and defense . When comparing strains, analyzing both bacterial export function and the corresponding plant response provides a more complete picture of NdvA's role in plant-bacterial interactions.

What are the most effective protocols for isolating and purifying recombinant NdvA protein?

Isolating and purifying recombinant NdvA protein requires specialized approaches due to its nature as a membrane-associated ATP-binding transport protein:

Expression Strategies:

  • Vector Selection:

    • Use vectors with tunable promoters (e.g., pET with T7lac promoter)

    • Consider fusion tags that enhance solubility (MBP, SUMO) as well as affinity purification

    • Include protease cleavage sites for tag removal if needed for functional studies

  • Expression Host:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Consider Rosetta strains if codon usage is a concern

    • For difficult cases, consider P. pastoris or insect cell expression systems

  • Induction Conditions:

    • Low temperature induction (16-20°C)

    • Reduced inducer concentration (0.1-0.5 mM IPTG)

    • Extended expression time (overnight to 48 hours)

Membrane Protein Extraction:

  • Cell Lysis:

    • Gentle mechanical disruption (e.g., French press at 10,000-15,000 psi)

    • Buffer composition: 50 mM Tris-HCl pH 7.5, 100-300 mM NaCl, 10% glycerol, 1 mM EDTA, protease inhibitors

  • Membrane Fraction Isolation:

    • Differential centrifugation: low-speed (10,000 × g, 20 min) to remove cell debris followed by high-speed (100,000 × g, 1 hour) to collect membrane fraction

    • Sucrose gradient centrifugation for higher purity of membrane fractions

  • Solubilization:

    • Screen detergents: n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), lauryl maltose neopentyl glycol (LMNG)

    • Typical conditions: 1% detergent, 4°C, gentle rotation for 1-2 hours

    • Include stabilizers: glycerol (10%), cholesterol hemisuccinate (CHS, 0.1%)

Purification Strategy:

  • Affinity Chromatography:

    • IMAC (Ni-NTA) for His-tagged constructs

    • Use detergent-containing buffers throughout purification

    • Gradual imidazole gradient to minimize co-purifying contaminants

  • Size Exclusion Chromatography:

    • Critical for removing aggregates and ensuring homogeneity

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 0.05% DDM, 10% glycerol

  • Functional Verification:

    • ATP binding assay using fluorescent ATP analogs

    • ATPase activity measurement using colorimetric phosphate release assays

For functional studies, consider reconstituting purified NdvA into proteoliposomes using E. coli lipid extracts or defined lipid mixtures to better mimic the native membrane environment.

How can researchers effectively measure beta-(1-->2)glucan export in real-time?

Measuring beta-(1-->2)glucan export in real-time presents technical challenges but several innovative approaches can provide valuable dynamic data:

Fluorescence-Based Approaches:

  • Fluorescently Labeled Glucan Precursors:

    • Incorporate fluorescent glucose derivatives during synthesis

    • Monitor appearance of fluorescence in extracellular medium

    • Quantify using microplate fluorometry with measurements at defined intervals

  • FRET-Based Reporter Systems:

    • Design FRET pairs that change signal upon glucan export

    • One component attached to the membrane, another to the glucan

    • Monitor FRET efficiency changes as export occurs

  • pH-Sensitive Fluorescent Tags:

    • Attach pH-sensitive fluorophores to glucan molecules

    • Exploit pH differences between intracellular and extracellular environments

    • Track changes in fluorescence properties upon export

Biosensor-Based Methods:

  • Surface Plasmon Resonance (SPR):

    • Immobilize beta-(1-->2)glucan-binding proteins on sensor chip

    • Flow culture supernatant over the sensor

    • Measure real-time binding as glucan is exported

  • Quartz Crystal Microbalance (QCM):

    • Similar principle to SPR but measures mass changes

    • Can detect nanogram-level changes in glucan concentration

  • Enzyme-Coupled Assays:

    • Use enzymes that specifically modify exported glucan

    • Couple to colorimetric or fluorescent readouts

    • Continuous monitoring in a plate reader format

Live Cell Imaging Approaches:

  • Fluorescent Protein Fusions:

    • Generate functional NdvA-fluorescent protein fusions

    • Visualize localization and potential conformational changes during transport

    • Correlate with appearance of glucan in extracellular space

  • Super-Resolution Techniques:

    • Apply PALM, STORM, or STED microscopy to visualize export sites

    • Track individual export events with nanometer precision

    • Combine with single-particle tracking for kinetic information

For any real-time measurement approach, researchers should validate the system by comparing with established endpoint assays and include appropriate controls, such as ATP-depleted conditions or inactive NdvA mutants. Statistical analysis of real-time data should account for the temporal correlation structure, potentially using time series analysis methods or repeated measures ANOVA3.

What experimental approaches can elucidate the structure-function relationship of NdvA?

Elucidating the structure-function relationship of NdvA requires integrating multiple experimental approaches that connect structural features to functional outcomes:

Structural Determination Methods:

  • X-ray Crystallography:

    • Challenges: Membrane protein crystallization is difficult

    • Solutions: Use of crystallization chaperones, lipidic cubic phase methods

    • Outcomes: High-resolution structural information if successful

  • Cryo-Electron Microscopy:

    • Particularly valuable for membrane proteins like NdvA

    • Can potentially capture different conformational states in the transport cycle

    • May require formation of larger complexes or use of antibody fragments for size enhancement

  • NMR Spectroscopy:

    • Suitable for studying dynamic regions and ligand interactions

    • May be limited to soluble domains or smaller fragments of NdvA

    • Provides valuable information on conformational changes upon ATP or substrate binding

Functional Mapping Approaches:

  • Systematic Mutagenesis:

    • Alanine-scanning mutagenesis of conserved residues

    • Charge-reversal mutations at potential substrate interaction sites

    • Conservative vs. non-conservative substitutions to probe specific interactions

  • Chimeric Protein Analysis:

    • Swap domains between NdvA and related transporters (e.g., ChvA, HlyB)

    • Identify regions responsible for substrate specificity

    • Map functional boundaries of essential domains

  • Cross-linking Studies:

    • Chemical cross-linking combined with mass spectrometry

    • Site-specific photo-cross-linking to capture transient interactions

    • Identification of residues in proximity during different stages of transport

Computational Methods:

  • Homology Modeling:

    • Based on structures of related ATP-binding transporters

    • Refinement using experimental constraints

    • Validation through targeted functional studies

  • Molecular Dynamics Simulations:

    • Probe conformational dynamics in membrane environment

    • Examine potential transport pathways for beta-(1-->2)glucan

    • Predict effects of mutations on structure and dynamics

  • Evolutionary Coupling Analysis:

    • Identify co-evolving residues likely to be functionally important

    • Guide experimental design for mutagenesis studies

    • Provide constraints for structural modeling

Integrative Structure-Function Analysis:

Structural ElementFunctional AssayExpected OutcomeInterpretation
ATP-binding domainATP hydrolysis rateMutations reduce ATP turnoverDirect catalytic role
Transmembrane helicesBeta-(1-->2)glucan exportMutations alter transport efficiencyChannel formation
Substrate-binding regionAffinity measurementsMutations change Km for glucanRecognition specificity
Domain interfacesConformational changesMutations affect couplingAllosteric communication

This integrative approach connects specific structural elements to their functional roles, providing a comprehensive understanding of how NdvA facilitates beta-(1-->2)glucan export. By combining data from multiple experimental approaches, researchers can develop a mechanistic model of the complete transport cycle.

How does plant gene expression respond to Agrobacterium with modified NdvA?

Plant gene expression responses to Agrobacterium with modified NdvA reveal important insights into host-pathogen interactions and the specific role of beta-(1-->2)glucan in this process:

Differential Plant Responses:

Research using cDNA-amplified fragment length polymorphism (AFLP) analysis has demonstrated that plants show significant transcriptional responses to Agrobacterium infection. Out of 16,000 cDNA fragments analyzed in Ageratum conyzoides plant cell cultures, 251 (1.6%) were differentially regulated 48 hours after cocultivation with Agrobacterium . Among 75 strongly regulated fragments, 56 were already showing regulation by 24 hours post-infection .

When comparing wildtype Agrobacterium to strains with modified NdvA (affecting beta-(1-->2)glucan export), several categories of plant genes show differential regulation:

Experimental Design Considerations:

When studying plant responses to Agrobacterium with modified NdvA, researchers should:

  • Use isogenic bacterial strains differing only in NdvA function

  • Include appropriate controls (mock inoculation, non-pathogenic bacteria)

  • Examine both early (hours) and late (days) responses

  • Apply genome-wide transcriptomics rather than targeted approaches

  • Validate key findings with RT-PCR and functional studies

These studies provide valuable insights into the specific role of beta-(1-->2)glucan in plant-Agrobacterium interactions and may reveal new targets for improving transformation efficiency or developing novel plant protection strategies.

What methodologies best assess the impact of NdvA mutations on plant transformation efficiency?

Assessing the impact of NdvA mutations on plant transformation efficiency requires systematic approaches that evaluate the transformation process at multiple levels:

Quantitative Transformation Assays:

  • Transient Expression Assays:

    • Co-cultivation of plant tissues with Agrobacterium carrying reporter genes (GUS, GFP)

    • Quantification of reporter expression 2-5 days post-infection

    • Statistical comparison between wildtype and NdvA mutant strains

    • Advantages: Rapid results, high throughput screening potential

  • Stable Transformation Assessment:

    • Full transformation protocol with selection for stably transformed plants

    • Calculation of transformation efficiency (transformants per explant)

    • Molecular confirmation of T-DNA integration by PCR or Southern blot

    • Advantages: Evaluates the complete transformation process

  • Quantitative Real-Time Monitoring:

    • Using luminescent reporters for non-destructive monitoring

    • Time-course analysis of transformation events

    • Determination of kinetic parameters of transformation

    • Advantages: Reveals temporal aspects of transformation efficiency

Mechanistic Analysis Methods:

  • Bacterial Attachment Assays:

    • Quantification of bacteria bound to plant cells/tissues

    • Microscopic visualization of attachment using fluorescent bacteria

    • Comparison between wildtype and NdvA mutant strains

    • Relevance: Beta-(1-->2)glucan may influence attachment, a prerequisite for transformation

  • T-DNA Transfer Monitoring:

    • Using split-GFP systems where reassembly occurs upon transfer

    • PCR-based detection of T-DNA in plant nuclei at early timepoints

    • Quantitative assessment of transfer efficiency

    • Relevance: Directly measures the key step in transformation

  • Plant Defense Response Analysis:

    • Transcriptomic analysis of defense gene activation

    • Measurement of reactive oxygen species production

    • Quantification of defense-related phytohormones

    • Relevance: NdvA-dependent beta-(1-->2)glucan may modulate plant defense, affecting transformation

Experimental Design Framework:

Level of AnalysisMethodologyTimeframeKey ParametersStatistical Approach
Bacterial FitnessGrowth curves, plant colonization24-48 hoursGrowth rate, survivalRepeated measures ANOVA
Attachment PhaseBinding assays, microscopy0-12 hoursAttachment efficiencyt-tests, ANOVA
T-DNA TransferMolecular detection, reporter systems12-48 hoursTransfer rate, timingTwo-way ANOVA
IntegrationSouthern blot, NGS2-14 daysIntegration pattern, copy numberChi-square analysis
ExpressionReporter quantification2-14 daysExpression level, stabilityMixed-effects models

When designing these experiments, researchers should account for plant genotype variability by using multiple plant lines or varieties. Additionally, environmental conditions should be carefully controlled, as they can significantly impact transformation efficiency independent of bacterial factors. Statistical design should include sufficient biological replicates and appropriate controls for each step of the transformation process3.

How does NdvA compare to homologous proteins in other bacterial species?

NdvA belongs to a family of ATP-binding transport proteins found across diverse bacterial species, with significant structural and functional similarities but important species-specific adaptations:

Homology with Key Bacterial Transporters:

The ndvA gene product of Rhizobium meliloti shows significant homology to the chvA locus of Agrobacterium tumefaciens, and can functionally substitute for it, indicating strong conservation of core transport mechanisms . Both proteins are involved in the export of beta-(1-->2)glucan, though potentially with species-specific modifications to the substrate or regulation.

NdvA also shows substantial homology to other bacterial ATP-binding transport proteins, with particularly strong relatedness to Escherichia coli HlyB, a protein involved in hemolysin export . This suggests conservation of the basic ATP-dependent transport mechanism across diverse substrate specificities.

Structural and Functional Comparison:

ProteinOrganismSize (kDa)SubstrateKey Functional DomainsSpecial Features
NdvAAgrobacterium tumefaciens~67Beta-(1-->2)glucanATP-binding, transmembranePlant interaction role
ChvAAgrobacterium tumefaciens~67Beta-(1-->2)glucanATP-binding, transmembraneVirulence factor
NdvARhizobium meliloti~67Beta-(1-->2)glucanATP-binding, transmembraneSymbiosis factor
HlyBEscherichia coli~80HemolysinATP-binding, transmembranePathogenesis factor
MDRMammalian cells~170Various drugsATP-binding, transmembraneMulti-drug resistance

Evolutionary and Functional Implications:

The homology between NdvA and mammalian MDR (multi-drug resistance) proteins is particularly interesting from an evolutionary perspective . This suggests that the ATP-binding cassette (ABC) transporter family represents an ancient and highly conserved mechanism for active transport across membranes.

The functional substitution capability between NdvA and ChvA indicates that these proteins have maintained core transport functions despite adaptation to different ecological niches - pathogenic (Agrobacterium) versus symbiotic (Rhizobium) interactions with plants. This suggests that the beta-(1-->2)glucan export mechanism is a fundamental aspect of plant-bacterial interactions that has been adapted for different purposes through evolution.

The specific adaptations in each homolog likely reflect the particular requirements of their ecological context, such as differences in host range, environmental conditions, or the precise role of beta-(1-->2)glucan in each species' lifestyle.

What insights can be gained from studying NdvA in the context of bacterial ATP-binding transporter evolution?

Studying NdvA in the context of bacterial ATP-binding transporter evolution provides valuable insights into both the fundamental mechanisms of membrane transport and the adaptive evolution of plant-microbe interactions:

Evolutionary Conservation of ATP-Binding Transporters:

NdvA belongs to the ATP-binding cassette (ABC) transporter superfamily, one of the largest and most ancient protein families. The significant homology between NdvA and diverse transporters such as E. coli HlyB and mammalian MDR proteins suggests that the core ATP-dependent transport mechanism evolved early and has been maintained across domains of life .

Key evolutionary insights include:

  • Core Mechanism Conservation:

    • The ATP-binding domains show the highest sequence conservation

    • This suggests strong selective pressure on the energy-coupling mechanism

    • Mutations in these regions are likely to be highly deleterious

  • Substrate Specificity Divergence:

    • Transmembrane domains show greater sequence divergence

    • This reflects adaptation to transport diverse substrates

    • Specific residues involved in beta-(1-->2)glucan recognition likely evolved to optimize transport of this particular substrate

  • Regulatory Domain Adaptation:

    • Regulatory elements may show species-specific adaptation

    • These adaptations likely fine-tune transporter activity to different environmental conditions

    • Integration with species-specific signaling networks

Evolutionary Trajectories in Plant-Associated Bacteria:

The presence of homologous beta-(1-->2)glucan exporters in both pathogenic Agrobacterium and symbiotic Rhizobium suggests that this transport system predates the divergence of these bacterial lineages . This raises fascinating questions about evolutionary trajectories:

  • Did the ancestral transporter function in a free-living context, with subsequent adaptation to plant interaction?

  • Was the original role related to plant association, with divergent adaptation to pathogenic versus symbiotic lifestyles?

  • How have horizontal gene transfer events shaped the evolution of these transporters?

Methodological Approaches for Evolutionary Analysis:

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees using homologous sequences

    • Identification of key branching points in transporter evolution

    • Correlation with ecological transitions or host range shifts

  • Selection Pressure Analysis:

    • Calculation of dN/dS ratios to identify regions under positive selection

    • Identification of conserved versus variable regions

    • Mapping of selection patterns to structural features

  • Ancestral Sequence Reconstruction:

    • Computational inference of ancestral transporter sequences

    • Experimental characterization of reconstructed proteins

    • Determination of ancestral substrate specificity and function

By integrating evolutionary analysis with structural and functional studies, researchers can develop a comprehensive understanding of how NdvA and related transporters have evolved to fulfill specialized roles in plant-bacterial interactions while maintaining the core ATP-dependent transport mechanism.

What emerging technologies could advance our understanding of NdvA function?

Several emerging technologies hold significant promise for advancing our understanding of NdvA function at the molecular, cellular, and systems levels:

Advanced Structural Biology Methods:

  • Cryo-Electron Tomography:

    • Allows visualization of NdvA in its native membrane environment

    • Can capture different conformational states during the transport cycle

    • May reveal interactions with other components of the export machinery

  • Single-Particle Analysis with Focused Classification:

    • Improved resolution of heterogeneous conformational states

    • Better understanding of the structural changes during ATP hydrolysis and transport

    • Potential to visualize substrate binding and translocation

  • Time-Resolved Crystallography:

    • Capturing transient states during the transport process

    • Using photocaged ATP or temperature jumps to trigger conformational changes

    • Providing dynamic insights beyond static structures

Advanced Genomic and Systems Biology Approaches:

  • CRISPR-Cas9 Base Editing:

    • Precise introduction of point mutations without double-strand breaks

    • High-throughput mutagenesis to map function at single-residue resolution

    • In vivo evolution of NdvA variants with altered properties

  • Ribosome Profiling and Translatomics:

    • Examining translation efficiency and regulation of NdvA

    • Understanding codon usage optimization for membrane insertion

    • Identifying potential translational pausing sites important for folding

  • Bacterial Multi-omics Integration:

    • Combining transcriptomics, proteomics, metabolomics, and phenomics

    • Constructing comprehensive models of beta-(1-->2)glucan synthesis and export

    • Identifying regulatory networks controlling NdvA expression and activity

Novel Imaging and Single-Molecule Technologies:

  • Super-Resolution Live-Cell Imaging:

    • Visualizing NdvA localization and dynamics at nanometer resolution

    • Tracking beta-(1-->2)glucan export in real time

    • Correlating transport events with bacterial-plant cell interactions

  • Single-Molecule Force Spectroscopy:

    • Measuring forces involved in substrate translocation

    • Determining energy landscapes of the transport process

    • Correlating ATP hydrolysis with mechanical work

  • Engineered Fluorescent Biosensors:

    • Sensors reporting on NdvA conformational states

    • Beta-(1-->2)glucan sensors for real-time export monitoring

    • ATP consumption reporters linked to transport activity

Computational and Artificial Intelligence Approaches:

  • AlphaFold2 and Related AI Structure Prediction:

    • Accurate prediction of NdvA structure and conformational states

    • Modeling of NdvA-substrate interactions

    • Prediction of mutational effects on structure and function

  • Molecular Dynamics with Enhanced Sampling:

    • Simulating complete transport cycles on biologically relevant timescales

    • Identifying energy barriers and rate-limiting steps

    • Guiding rational design of modified transporters

  • Machine Learning for Pattern Recognition:

    • Identifying subtle phenotypic effects of NdvA variants

    • Predicting functional outcomes from sequence information

    • Discovering non-obvious relationships in complex datasets

These emerging technologies, particularly when applied in complementary combinations, have the potential to revolutionize our understanding of NdvA function and the broader mechanisms of bacterial polysaccharide export in plant-microbe interactions.

What are the potential biotechnological applications of engineered NdvA proteins?

Engineered NdvA proteins hold significant potential for various biotechnological applications, leveraging their natural role in polysaccharide export for novel purposes:

Plant Biotechnology Applications:

  • Enhanced Plant Transformation Systems:

    • Engineering NdvA variants to optimize beta-(1-->2)glucan export

    • Improving Agrobacterium attachment and T-DNA transfer efficiency

    • Developing strains with broader host range for recalcitrant species

    • Potential impact: Higher transformation efficiency for crop improvement

  • Modulation of Plant Immune Responses:

    • Controlled delivery of beta-(1-->2)glucan to trigger specific defense pathways

    • Engineering NdvA to export modified polysaccharides with enhanced or altered signaling properties

    • Development of plant priming agents for sustainable agriculture

    • Potential impact: Non-chemical approaches to crop protection

  • Symbiotic Enhancement:

    • Engineering rhizobial strains with optimized NdvA function

    • Improving nodulation efficiency in legume crops

    • Expanding host range of nitrogen-fixing bacteria

    • Potential impact: Reduced fertilizer requirements in agriculture

Bioproduction Applications:

  • Polysaccharide Manufacturing:

    • Engineering NdvA to export modified beta-(1-->2)glucans with novel properties

    • Development of bacterial "factories" for industrial polysaccharide production

    • Controlling molecular weight and modification patterns of exported products

    • Potential impact: New biomaterials for medical and industrial applications

  • Vaccine Development:

    • Using engineered NdvA to export antigenic polysaccharides

    • Development of bacterial vectors for polysaccharide-based vaccines

    • Controlling immunogenicity through polysaccharide modifications

    • Potential impact: Novel vaccination approaches for challenging pathogens

  • Bioremediation Applications:

    • Engineering NdvA to export polysaccharides that bind environmental contaminants

    • Development of bacteria that can sequester heavy metals or organic pollutants

    • Immobilization of toxins in soil or water environments

    • Potential impact: Green technologies for environmental cleanup

Research Tool Applications:

  • Designer Cell Surface Engineering:

    • Modifying bacterial surfaces with customized polysaccharides

    • Creating bacteria with novel binding properties or cellular interactions

    • Developing living probes for biological research

    • Potential impact: New research tools for studying cellular interactions

  • Biosensing Platforms:

    • Engineering NdvA-based export systems coupled to detection mechanisms

    • Development of whole-cell biosensors that export reporter molecules

    • Real-time monitoring of cellular responses to environmental stimuli

    • Potential impact: Novel diagnostic and environmental monitoring tools

  • Synthetic Biology Chassis:

    • Incorporating engineered NdvA as a component of synthetic cellular systems

    • Enabling controlled export of synthetic products

    • Creating modular export systems for synthetic biology applications

    • Potential impact: Expanding the toolkit for synthetic biology

The realization of these applications will require overcoming several challenges, including optimizing protein expression, ensuring proper folding and function, and adapting the system to various host organisms. Additionally, regulatory considerations for genetically modified organisms would need to be addressed for applications outside contained laboratory settings.

What are the key unresolved questions about NdvA function that should be prioritized in future research?

Several critical unresolved questions about NdvA function should be prioritized in future research to advance our understanding of this important bacterial transport protein:

Structural Mechanisms:

  • Conformational Dynamics:

    • How does ATP binding and hydrolysis couple to substrate transport?

    • What are the intermediate conformational states during the transport cycle?

    • How do transmembrane and ATP-binding domains communicate?

    • Research approach: Time-resolved structural studies, FRET-based conformational sensors

  • Substrate Recognition:

    • Which specific residues are involved in beta-(1-->2)glucan recognition?

    • Is there a size limit or structural requirement for transported substrates?

    • Do post-translational modifications affect substrate specificity?

    • Research approach: Systematic mutagenesis, binding assays with modified substrates

  • Oligomeric State:

    • Does NdvA function as a monomer, dimer, or higher-order oligomer?

    • How does oligomerization affect transport efficiency?

    • Are there accessory proteins that form a complete transport complex?

    • Research approach: Native mass spectrometry, crosslinking studies, blue native PAGE

Regulatory Mechanisms:

  • Expression Control:

    • How is ndvA expression regulated in response to environmental signals?

    • What transcription factors control ndvA expression during plant interaction?

    • Does NdvA abundance correlate with virulence or symbiotic potential?

    • Research approach: Promoter analysis, transcription factor identification, reporter fusions

  • Post-translational Regulation:

    • Is NdvA activity modulated by phosphorylation or other modifications?

    • Do plant-derived signals directly affect NdvA function?

    • How is NdvA activity coordinated with beta-(1-->2)glucan synthesis?

    • Research approach: Phosphoproteomics, activity assays with purified kinases/phosphatases

  • Metabolic Integration:

    • How is NdvA function integrated with cellular energy status?

    • Is there feedback regulation between export efficiency and synthesis?

    • How does nutrient availability impact export activity?

    • Research approach: Metabolic flux analysis, export studies under varied nutritional conditions

Biological Significance:

  • Plant-Specific Roles:

    • How does beta-(1-->2)glucan export specifically contribute to plant transformation?

    • Are there plant receptors that directly recognize exported beta-(1-->2)glucan?

    • How do different plant species respond to beta-(1-->2)glucan?

    • Research approach: Comparative plant transcriptomics, receptor identification, diverse plant species testing

  • Ecological Context:

    • How does NdvA function vary across natural Agrobacterium populations?

    • Is there evidence for host-specific adaptation in NdvA sequence or regulation?

    • How does beta-(1-->2)glucan export contribute to survival in soil environments?

    • Research approach: Population genomics, environmental sampling, competition assays

  • Evolutionary History:

    • What was the ancestral function of NdvA-like transporters?

    • How did pathogenic and symbiotic functions diverge?

    • Has horizontal gene transfer played a role in NdvA evolution?

    • Research approach: Phylogenetic analysis, ancestral sequence reconstruction, comparative genomics

Addressing these unresolved questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, plant biology, and evolutionary analysis. The integration of these diverse perspectives will provide a comprehensive understanding of NdvA function and its significance in bacterial-plant interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.