Recombinant Agrobacterium tumefaciens Conjugal transfer protein traG (traG)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics of TraG

TraG is encoded by the traG gene, part of the traCDG operon located on the Ti plasmid of A. tumefaciens. Key features include:

  • Operon Structure: The traCDG operon is regulated by the quorum-sensing activator TraR, which responds to the autoinducer 3-oxo-C8-HSL .

  • Protein Domains: TraG is hypothesized to function as a relaxase accessory protein, interacting with TraA (a helicase/nickase) and TraD to form a relaxosome complex at the origin of transfer (oriT) .

  • Conservation: TraG homologs are found in other conjugation systems, such as the RP4 plasmid, where they mediate DNA transfer via NTP hydrolysis and interaction with relaxases .

Functional Role in Conjugal DNA Transfer

TraG is indispensable for Ti plasmid conjugation, as demonstrated by experimental evidence:

  • Relaxosome Assembly: TraG collaborates with TraA and TraD to process plasmid DNA at oriT, enabling single-stranded DNA (ssDNA) transfer .

  • Complementation Studies: Deletion of traG (e.g., in plasmid pDB127) abolishes conjugation, but functionality is restored when recombinant TraG from RP4 or Ti plasmids is supplied in trans .

  • Cross-System Compatibility: TraG from RP4 can substitute for Ti plasmid TraG, and vice versa, indicating functional conservation across bacterial conjugation systems .

Table 1: Functional Complementation of traG Mutants

SystemtraG SourceConjugation Efficiency RestorationCitation
Ti plasmid (pTiC58ΔaccR)RP4 TraGFull
RP4 plasmidTi plasmid TraGPartial

Interactions with Conjugation Machinery

  • TraR Regulation: Expression of traG is activated by TraR, which binds the quorum-sensing signal 3-oxo-C8-HSL .

  • Antiactivator Modulation: TraM, an antiactivator, inhibits TraR and indirectly suppresses traG expression, linking conjugation to bacterial population density .

  • DNA Binding: TraG-like proteins in related systems (e.g., RP4 TraG) exhibit nonspecific DNA binding and oligomerization, suggesting a role in forming transfer pores .

Recombinant TraG Production and Applications

  • Cloning and Expression: Recombinant TraG has been produced in E. coli and A. tumefaciens for functional studies, enabling genetic complementation and biochemical characterization .

  • Biotechnological Relevance: Engineering TraG variants could enhance plasmid transfer efficiency in plant transformation systems or synthetic biology applications .

Key Research Findings

  • Essentiality: traG knockout strains fail to transfer Ti plasmids, underscoring its nonredundant role in conjugation .

  • Quorum-Sensing Dependence: TraG expression is tightly coupled to bacterial cell density via TraR-TraM interactions .

  • Evolutionary Insight: TraG’s functional overlap with VirD4 (a type IV secretion system ATPase) suggests evolutionary divergence from ancestral conjugation systems .

Unresolved Questions and Future Directions

  • Mechanistic Details: The precise biochemical role of TraG in relaxosome activity remains unclear, warranting structural studies.

  • Host Interactions: How TraG interfaces with plant factors during T-DNA transfer (vs. interbacterial conjugation) is underexplored .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For precise delivery estimates, we encourage you to consult your local distributors.
Please note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are collected at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
traG; Atu6124; AGR_pTi_bx12; Conjugal transfer protein TraG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-658
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
traG
Target Protein Sequence
MTMNRLLLLILPAIIMLAAMFATSGMEQRLAAFGTSPQAKLMLGRAGLALPYIAAVAIGI IGLFAANGSANIKAAGLSVLAGSGVVITIATLREVIRLNSIASSVPAEQSVLAYADPVTM IGASIAFISGMFALRVAIKGNAAFATTAPKRIGGKRAVHGEADWMKIQEAAKLFPERGGI IIGERYRVDRDSVAAMPFRADDRQSWGAGGKSPLLCFDGSFGSSHGIVFAGSGGFKTTSV TIPTALKWGGGLVVLDPSSEVAPMVCEHRRQAGRKVIVLDPTAGGVGFNALDWIGRHGNT KEEDIVAVATWIMTDNPRTASARDDFFRASAMQLLTALIADVCLSGHTETEDQTLRRVRA NLSEPEPKLRARLTKIYEGSESDFVKENVSVFVNMTPETFSGVYANAVKETHWLSYPNYA GLVSGDSFSTDDLADGGTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGNVKGRTLF LLDEVARLGYLRILETARDAGRKYGIMLTMIFQSLGQMREAYGGRDATSKWFESASWISF AAINDPDTADYISKRCGDTTVEVDQTNRSTGMKGSSRSRSKQLSRRPLILPHEVLHMRSD EQIVFTSGNPPLRCGRAIWFRRDDMKACVGENRFHRTGTGTDTHTEHAPPWQKEGTRP
Uniprot No.

Target Background

Database Links

KEGG: atu:Atu6124

Protein Families
VirD4/TraG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the TraG protein and what role does it play in Agrobacterium tumefaciens?

TraG is a crucial component of the conjugal transfer system in Agrobacterium tumefaciens, functioning as part of the Type IV secretion machinery that facilitates DNA transfer between bacteria and from bacteria to plants. TraG belongs to the coupling protein family, which connects the DNA transfer and replication (Dtr) components to the mating pair formation (Mpf) system, similar to how VirD4 functions in the T-DNA transfer process . The protein acts as a coupling factor that links the relaxosome (the nucleoprotein complex formed at the origin of transfer) with the membrane-spanning transport apparatus, thereby enabling substrate transfer across bacterial membranes . In A. tumefaciens, TraG is specifically involved in conjugal plasmid transfer, facilitating the movement of genetic material that can contribute to bacterial adaptation and evolution.

How does the function of TraG differ from other conjugal transfer proteins in Agrobacterium?

TraG functions distinctly from other conjugal transfer proteins in Agrobacterium through its specialized coupling role. While VirB proteins form the actual transport channel of the type IV secretion system, and VirD2 is responsible for recognition and cleavage at the border sequences of T-DNA , TraG acts as a connector between the DNA processing machinery and the secretion apparatus. Unlike the AvhB system, which mediates the conjugal transfer of the pAtC58 cryptic plasmid independently of the Ti plasmid-encoded systems , TraG is typically associated with Ti plasmid transfer. The protein shows functional similarities to VirD4 but operates in different genetic contexts, with TraG primarily functioning in bacterial conjugation while VirD4 is essential for T-DNA transfer to plant cells . This functional specialization allows Agrobacterium to maintain distinct yet related mechanisms for different types of DNA transfer.

What is the relationship between TraG and the Type IV secretion system in bacterial conjugation?

TraG represents an integral component of the Type IV secretion system, which in Agrobacterium has evolved specialized functions for both conjugation and inter-kingdom gene transfer. The phylogenetic and functional relationships between conjugal transfer systems and type IV secretion systems have led to their classification within a type IV superfamily of proteins involved in both bacterial conjugation and virulence factor transit to eukaryotic hosts . TraG specifically functions within this framework as a coupling protein that enables substrate selection and transfer initiation. The protein is part of a sophisticated molecular machinery that includes both Dtr-like components (similar to the tra system required for pTiC58 conjugal transfer) and Mpf components that form the actual channel . This relationship underscores the evolutionary conservation of DNA transfer mechanisms across different biological contexts in Agrobacterium.

How do substrate interactions between TraG and other DNA transfer systems affect conjugation efficiency?

Research has demonstrated complex substrate interactions among different DNA transfer systems in Agrobacterium. For example, the presence of plasmid TiC58 or plasmid RSF1010 reduces the conjugal transfer efficiency of pAtC58 by 10-fold or 1,000-fold, respectively . These interactions likely involve competition for shared cellular resources or direct interference between different transfer systems. For TraG specifically, its substrate recognition and coupling functions may be inhibited when multiple transfer systems are simultaneously active. When designing experiments to study TraG function, researchers should carefully consider the genetic background of their Agrobacterium strains, as the presence of multiple plasmids with different transfer systems can significantly impact conjugation efficiency measurements. Methodologically, this requires creating controlled experimental systems where competing transfer systems are systematically inactivated or regulated to isolate TraG-specific effects.

What structural domains of TraG are critical for its coupling function in type IV secretion?

The TraG protein contains several functionally critical domains that enable its coupling activity. The N-terminal region typically includes transmembrane domains that anchor the protein to the inner membrane, while the C-terminal region extends into the cytoplasm and contains ATP-binding motifs essential for energizing the transfer process. Structural studies suggest that TraG forms hexameric complexes that undergo conformational changes during substrate recruitment and transfer initiation. Key functional domains include:

DomainPositionFunctionConservation
TransmembraneN-terminalMembrane anchoringModerately conserved
Walker A motifCentralATP bindingHighly conserved
Walker B motifCentralATP hydrolysisHighly conserved
Substrate bindingC-terminalDNA/protein recognitionVariable
Interaction domainVariousContact with secretion channelModerately conserved

Experimental approaches to study these domains include site-directed mutagenesis to disrupt specific motifs, followed by conjugation efficiency assays to assess functional impacts. Advanced structural techniques such as cryo-electron microscopy can provide insights into how these domains interact during the conjugation process.

How has the evolution of TraG contributed to the adaptation of Agrobacterium as a plant pathogen?

The evolution of TraG represents a fascinating example of molecular adaptation that has contributed to Agrobacterium's unique ecological niche. Comparative genomic analyses suggest that the conjugal transfer machinery, including TraG, evolved from ancestral systems involved in horizontal gene transfer between bacteria. The specialization of this machinery to facilitate inter-kingdom DNA transfer represents a key evolutionary innovation that enabled Agrobacterium to become an effective plant pathogen. TraG-like coupling proteins show sequence and functional conservation across various bacterial species, but the Agrobacterium variants have acquired specialized features that optimize interaction with plant-associated substrates. This evolutionary trajectory has implications for understanding bacterial pathogenesis more broadly and highlights the importance of horizontal gene transfer in microbial adaptation. Research approaches to study this evolution include phylogenetic analysis of TraG homologs across bacterial species and functional complementation experiments to test cross-species compatibility.

What are the most effective expression systems for producing recombinant TraG protein?

The expression of fully functional recombinant TraG presents technical challenges due to its large size, membrane association, and complex tertiary structure. Several expression systems have been successfully employed:

Expression SystemAdvantagesLimitationsYield
E. coli BL21(DE3)Rapid growth, high yieldMay form inclusion bodiesMedium-high
Agrobacterium-basedNative environment, proper foldingSlower growth, lower yieldLow-medium
Baculovirus/insect cellsEukaryotic processing, solubilityComplex setup, expensiveMedium
Cell-free systemsAvoids toxicity issuesLimited scale, expensiveLow

For optimal results, the TraG coding sequence should be optimized for the host's codon usage and equipped with an appropriate affinity tag (His-tag being common) for purification . Expression conditions require careful optimization, with lower temperatures (16-18°C) often improving folding. For membrane proteins like TraG, solubilization strategies using mild detergents or nanodisc technology may be necessary to maintain native conformation. The carrier-free approach, similar to that used for other recombinant proteins, can be advantageous for applications where the presence of carrier proteins like BSA might interfere .

What recombineering approaches are most suitable for genetic manipulation of traG in Agrobacterium?

  • The PluγET RHI145 system has demonstrated high efficiency in A. tumefaciens C58

  • The RecETh1h2h3h4 AGROB6 system works effectively in A. tumefaciens EHA105

  • Lambda Red-based systems can be functional but typically show lower recombination efficiency

The methodological approach involves:

  • Designing homology arms (50-500 bp) flanking the traG region to be modified

  • Creating a recombineering cassette carrying the desired modification

  • Transforming the recombineering plasmid into Agrobacterium

  • Inducing expression of the recombinase system

  • Introducing the recombineering cassette

  • Selecting for successful recombinants using appropriate markers

This approach enables various modifications including gene knockouts, point mutations, and insertions, allowing researchers to create precise alterations to study TraG function . When designing experiments, the choice of recombineering system should be tailored to the specific Agrobacterium strain being used.

How can conjugation efficiency mediated by TraG be quantitatively assessed?

Quantitative assessment of TraG-mediated conjugation efficiency is critical for functional studies. Several methodological approaches provide reliable measurements:

  • Marker-based conjugation assays: Using donor strains with traG variants and recipient strains with selectable markers. Conjugation frequency is calculated as the number of transconjugants per donor cell.

  • Fluorescence-based systems: Utilizing fluorescent proteins as reporters in recipient cells that are activated upon successful conjugation, allowing for flow cytometry quantification.

  • Real-time PCR quantification: Measuring the copy number of transferred DNA in recipient cells relative to chromosomal markers.

  • Binding assays with recombinant proteins: When recombinant TraG protein is immobilized (similar to methods used for other proteins at concentrations of 2 μg/mL), binding affinities with interaction partners can be measured with ED50 values .

Experimental design should include appropriate controls, such as traG deletion mutants and complementation strains. Environmental factors significantly impact conjugation efficiency, so temperature, pH, and growth phase should be carefully controlled. Researchers should be aware that competing DNA transfer systems can dramatically reduce conjugation efficiency, as seen with the 10-fold reduction when TiC58 is present and 1,000-fold reduction with RSF1010 .

How does TraG function relate to improving Agrobacterium-mediated plant transformation efficiency?

The optimization of TraG function represents a promising avenue for enhancing Agrobacterium-mediated plant transformation, which remains a cornerstone technique in plant biotechnology. Understanding the role of TraG in conjugal transfer provides insights that can be translated to T-DNA transfer improvement strategies. While TraG primarily functions in bacterial conjugation rather than plant transformation, the mechanistic similarities between these processes suggest potential crossover applications. Research indicates that factors affecting conjugal transfer efficiency often also impact transformation capabilities.

Experimental approaches for leveraging TraG knowledge include:

  • Engineering TraG variants with enhanced coupling efficiency and applying these insights to VirD4 modification

  • Exploring the potential for TraG to complement or synergize with the VirB/D4 system

  • Investigating how TraG-mediated plasmid transfer might be utilized to introduce additional virulence factors

These approaches must consider the complex interplay of factors affecting transformation, including the inhibitory effect of gamma-aminobutyric acid (GABA) on T-DNA transfer . Studies have shown that reducing GABA levels in plant tissues can increase transformation frequency, suggesting that engineering Agrobacterium strains with modified TraG and GABA metabolism could provide synergistic benefits .

What role does TraG play in the interaction of Agrobacterium with different plant species?

TraG's involvement in conjugation systems has indirect but significant implications for Agrobacterium's host range and interaction with different plant species. While not directly involved in plant transformation, the horizontal gene transfer facilitated by TraG contributes to the genetic plasticity of Agrobacterium populations, potentially enabling adaptation to new plant hosts. Research approaches to study this relationship include:

  • Comparative genomic analysis of traG variants across Agrobacterium strains with different host specificity

  • Experimental evolution studies tracking changes in TraG and conjugation systems during adaptation to novel plant hosts

  • Creation of chimeric transfer systems incorporating components from TraG and virulence proteins

These investigations should account for plant factors that influence Agrobacterium interactions, such as GABA levels, which have been shown to inhibit T-DNA transfer . Different plant species and even varieties within species can vary significantly in their GABA content and distribution, potentially affecting both conjugation and transformation processes. When designing experiments to study these interactions, researchers should consider using plant lines with altered GABA metabolism as experimental systems .

What are common challenges in working with recombinant TraG and how can they be addressed?

Working with recombinant TraG presents several technical challenges that researchers should anticipate and address:

ChallengeCauseSolution
Low expression yieldMembrane protein toxicityUse tightly controlled inducible promoters, lower induction temperatures (16-18°C)
Protein insolubilityHydrophobic transmembrane domainsAdd solubilization tags, use specialized detergents, employ nanodisc technology
Loss of functionImproper foldingExpress in homologous systems, use chaperone co-expression strategies
Protein degradationProtease sensitivityInclude protease inhibitors, optimize purification speed, use carrier-free formulations
Aggregation during storageFreeze-thaw damageUse a manual defrost freezer and avoid repeated freeze-thaw cycles

For functional studies, recombinant TraG should be reconstituted in appropriate membrane mimetics. Based on protocols for similar proteins, reconstitution at approximately 250 μg/mL in appropriate buffers is recommended . When working with lyophilized protein, reconstitution from a 0.2 μm filtered solution in Tris and NaCl buffers helps maintain structural integrity . For long-term storage, aliquoting the protein and storing at -80°C is advisable to prevent degradation from repeated freeze-thaw cycles.

How can researchers troubleshoot failed conjugation experiments involving TraG?

Troubleshooting conjugation experiments requires systematic evaluation of multiple factors:

  • Donor strain viability and plasmid stability:

    • Verify plasmid maintenance using appropriate selective markers

    • Confirm TraG expression using western blotting or activity assays

    • Ensure donor strain growth conditions are optimal

  • Recipient strain competence:

    • Check recipient strain viability and growth phase

    • Verify absence of restriction systems that might degrade incoming DNA

    • Optimize recipient to donor ratio (typically 1:1 to 3:1)

  • Conjugation conditions:

    • Control temperature (28°C optimal for Agrobacterium)

    • Optimize mating duration (4-24 hours depending on system)

    • Ensure proper contact between cells on solid media

  • Selection and detection methods:

    • Verify selective marker functionality

    • Rule out spontaneous resistance

    • Consider using dual selection systems

  • Competing transfer systems:

    • Be aware that the presence of TiC58 or RSF1010 can reduce transfer efficiency by 10-fold or 1,000-fold, respectively

    • Consider using strains with simplified plasmid profiles

For advanced troubleshooting, fluorescence microscopy can visualize conjugation bridge formation, and genetic complementation with wild-type traG can confirm specificity of observed defects.

What considerations are important when designing recombineering experiments targeting traG in Agrobacterium?

Successful recombineering of traG requires careful experimental design:

  • Selection of appropriate recombineering system:

    • The PluγET RHI145 system shows high efficiency in A. tumefaciens C58

    • The RecETh1h2h3h4 AGROB6 system works well in A. tumefaciens EHA105

    • Consider strain-specific optimization of recombinase expression

  • Homology arm design:

    • Optimal length ranges from 50-500 bp

    • Avoid repetitive sequences that may lead to off-target recombination

    • Consider GC content and secondary structure

  • Modification strategy:

    • For point mutations, incorporate silent markers to facilitate screening

    • For deletions, consider potential polar effects on downstream genes

    • For tag insertions, verify that fusion location doesn't disrupt critical domains

  • Selection and screening approach:

    • Design appropriate selective markers

    • Develop PCR strategies to verify correct modifications

    • Consider phenotypic assays to confirm functional impacts

  • Controls and validation:

    • Include wild-type controls in all experiments

    • Perform complementation to confirm phenotype specificity

    • Sequence the modified region to verify precise editing

The conventional RecA-mediated recombination system has traditionally been employed but is cumbersome and time-consuming. The newer recombineering systems based on phage recombinases from Agrobacterium and related species represent more efficient alternatives for genetic manipulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.