Recombinant Agrobacterium tumefaciens Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fliP; Atu0546; AGR_C_963; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
fliP
Target Protein Sequence
MIRFLVTIAVLLALPGLANAQQFPSDLFNTQIDGSVAAWIIRTFGLLTVLSVAPGILIMV TSFPRFVIAFSILRSGMGLASTPSNMILLSMAMFMTFYVMSPTFDKAWTDGVQPLLQNQI NEQQAVQRIAEPFRTFMNANTRDKDLKLFVDIARERGQVVMTDNVVDYRVLVPAFMLSEI RRGFEIGFLIILPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVGSL VRSFN
Uniprot No.

Target Background

Function
Plays a role in the flagellum-specific transport system.
Database Links

KEGG: atu:Atu0546

STRING: 176299.Atu0546

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the function of flagellar biosynthetic protein FliP in Agrobacterium tumefaciens?

FliP is a critical component of the flagellar export apparatus in A. tumefaciens, functioning as an integral membrane protein within the MS ring complex. It forms part of the core structure that facilitates the export of flagellar proteins through the central channel of the growing flagellum. In A. tumefaciens, FliP contributes to bacterial motility, which is important for soil navigation and reaching plant wound sites during the initial stages of infection. The protein works cooperatively with other flagellar proteins to enable proper assembly and function of the flagellar system .

How does flagellar motility contribute to A. tumefaciens pathogenicity?

Flagellar motility enables A. tumefaciens to navigate through soil environments and locate wounded plant tissues that release phenolic compounds. This directed movement is crucial for the initial stages of infection. Once the bacterium reaches the plant, it attaches to plant cells through specific interactions, initiates virulence (Vir) gene expression, and deploys its Type IV Secretion System (T4SS) to transfer tumor-inducing (Ti) plasmid segments into the plant cell . Research indicates that flagellar motility mutants show reduced virulence compared to wild-type strains, demonstrating the important role of functional flagella in the infection process .

What is the relationship between flagellar proteins and membrane microdomains in A. tumefaciens?

Flagellar proteins in A. tumefaciens, including FliP, may associate with specialized membrane microdomains known as detergent-resistant membranes (DRMs). These membrane compartments contain SPFH (stomatin/prohibitin/flotillin/HflKC) proteins that promote the correct assembly of membrane protein complexes . The localization of flagellar assembly components to these microdomains likely facilitates the efficient assembly of the flagellar apparatus. Research has shown that disruption of these membrane microdomains can affect the proper localization and function of various membrane-associated protein complexes in A. tumefaciens, potentially including flagellar structures .

What are the optimal conditions for expressing recombinant A. tumefaciens FliP protein?

For optimal expression of recombinant A. tumefaciens FliP protein, researchers should consider the following protocol:

  • Expression System Selection: Use E. coli BL21(DE3) for initial expression attempts, as this strain lacks certain proteases and contains the T7 RNA polymerase necessary for high-level protein expression.

  • Vector Construction: Clone the fliP gene into a pET vector system with an N-terminal His-tag to facilitate purification while minimizing interference with protein folding.

  • Growth Conditions:

    • Culture medium: LB or TB supplemented with appropriate antibiotics

    • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

    • Post-induction temperature: 16-18°C for 16-18 hours (reduced temperature minimizes inclusion body formation for membrane proteins)

  • Membrane Fraction Isolation: Harvest cells and disrupt using sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors. Isolate membrane fractions through ultracentrifugation as described for DRM isolation protocols .

  • Detergent Solubilization: Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration.

This methodology draws on established techniques for membrane protein expression while considering the specific properties of FliP as an integral membrane protein.

How can FliP protein localization be visualized in A. tumefaciens cells?

Visualization of FliP protein localization in A. tumefaciens cells can be achieved through several complementary techniques:

  • Fluorescent Protein Fusion:

    • Generate a C-terminal GFP fusion to FliP (FliP-GFP) using a low-copy plasmid under native promoter control

    • Express in A. tumefaciens cells and visualize using fluorescence microscopy

    • Compare localization patterns with other flagellar components to identify potential co-localization

  • Immunofluorescence Microscopy:

    • Generate FLAG-tagged FliP constructs expressed from their native gene locus

    • Fix bacteria with 4% paraformaldehyde and permeabilize with 0.1% Triton X-100

    • Detect using FLAG-tag specific primary antibodies followed by fluorescent secondary antibodies (e.g., AlexaFluor 488)

    • This approach has successfully revealed spotty localization patterns for other membrane proteins in A. tumefaciens

  • Biochemical Fractionation:

    • Perform membrane fractionation to separate detergent-resistant membranes (DRMs) from detergent-sensitive membranes (DSMs)

    • Use Western blot analysis with protein-specific antibodies to detect FliP in different fractions

    • Compare fractionation patterns with known DRM-associated proteins like HflC or Atu3772

Based on patterns observed with other membrane proteins in A. tumefaciens, FliP might exhibit a spotty localization pattern along the bacterial membrane, particularly if it associates with specialized microdomains .

What methods can be used to assess the impact of FliP mutations on A. tumefaciens motility and virulence?

To comprehensively assess the impact of FliP mutations on A. tumefaciens motility and virulence, researchers should employ a multi-faceted approach:

Motility Assessment:

  • Soft Agar Motility Assays: Inoculate wild-type and FliP mutant strains onto 0.3% agar plates and measure swimming zone diameters after 48-72 hours at 28°C.

  • Video Microscopy: Track individual bacterial movements using phase-contrast microscopy combined with motion tracking software to quantify swimming speed and pattern changes.

  • Electron Microscopy: Use transmission electron microscopy with negative staining to directly visualize flagellar structures and confirm assembly defects in mutants.

Virulence Assessment:

  • Plant Transformation Assays: Assess the ability of mutants to transform plant cells using the GUS reporter system with Arabidopsis seedlings, following this protocol:

    • Prepare A. tumefaciens strains harboring pBISN1 with gusA-intron

    • Cultivate in AB minimal medium for virulence induction

    • Infect Arabidopsis seedlings for 3 days

    • Measure transient GUS expression by X-Gluc staining

  • Tumor Formation Assays: Inoculate wounded plant tissues (such as potato tuber discs) with wild-type and mutant strains, then quantify tumor size and number after 3-4 weeks.

  • T-DNA Transfer Efficiency: Use quantitative PCR to measure T-DNA transfer rates to plant cells, providing a direct molecular assessment of transformation efficiency.

Secretion System Function:

  • T6SS Activity Assessment: Evaluate T6SS-dependent secretion of TssD (Hcp) to determine if FliP mutations affect other secretion systems:

    • Grow cultures in AB minimal medium at 30°C for 6 hours

    • Prepare total protein samples using SDS sample buffer

    • Filter and concentrate supernatants by TCA precipitation

    • Analyze by SDS-PAGE and Western detection using TssD-specific antibodies

This multi-method approach allows researchers to distinguish between direct effects on flagellar assembly versus indirect effects on other virulence-related systems.

How might FliP interact with the Type IV and Type VI secretion systems in A. tumefaciens?

Research suggests potential functional interactions between flagellar components like FliP and other secretion systems in A. tumefaciens:

Potential Interaction Mechanisms:

  • Shared Membrane Microdomains: Both flagellar assembly components and secretion system proteins may localize to specialized membrane microdomains. Proteomic analysis of detergent-resistant membranes (DRMs) from A. tumefaciens has identified components of the T4SS-like AvhB system (AvhB9-11) and the T6SS component TssL . FliP may similarly reside in these microdomains, creating opportunities for physical proximity and functional interaction.

  • Regulatory Crosstalk: Flagellar components and secretion systems respond to overlapping environmental signals. For example, the T6SS is induced in acidic environments, while the T4SS responds to phenolic compounds from wounded plant cells . These shared regulatory inputs suggest the possibility of coordinated expression and activity.

  • Structural Connections: As integral membrane complexes, the flagellar export apparatus (including FliP) and secretion systems may utilize similar membrane-spanning mechanisms and potentially share accessory proteins for assembly or stability.

Experimental Approaches to Investigate Interactions:

  • Co-immunoprecipitation Studies: Perform pull-down experiments with tagged FliP to identify physical interactions with components of the T4SS or T6SS.

  • Fluorescence Microscopy: Use dual-labeling approaches to visualize potential co-localization between FliP and secretion system components.

  • Genetic Interaction Analysis: Create combinatorial mutations in flagellar and secretion system genes to identify synthetic phenotypes that would suggest functional relationships.

This research direction may reveal previously unappreciated connections between bacterial motility and secretion system function in plant pathogenesis.

What structural features of FliP are critical for flagellar assembly in A. tumefaciens?

The structural features of FliP critical for flagellar assembly in A. tumefaciens can be investigated through comprehensive mutagenesis and structural analysis:

Key Structural Features:

  • Transmembrane Domains: FliP typically contains 4-5 transmembrane segments that anchor it within the inner membrane. Systematic alanine scanning of these regions can identify residues critical for membrane integration and protein stability.

  • Periplasmic Loops: The periplasmic domains likely interact with other flagellar export apparatus components. Deletion analysis of these regions can reveal their contribution to protein-protein interactions necessary for flagellar assembly.

  • Conserved Motifs: Multiple sequence alignment of FliP proteins across bacterial species reveals highly conserved motifs. Site-directed mutagenesis of these conserved residues can determine their functional significance.

Experimental Approach to Structure-Function Analysis:

Structural FeatureExperimental MethodExpected Outcome Measurement
Transmembrane domainsAlanine scanning mutagenesisMembrane integration (Western blot of membrane fractions)
Periplasmic loopsDeletion analysisProtein-protein interactions (Bacterial two-hybrid assays)
Conserved motifsSite-directed mutagenesisFlagellar assembly and function (Motility assays)
Oligomerization interfacesCysteine cross-linkingComplex formation (SDS-PAGE under non-reducing conditions)

Structural Prediction and Modeling:

While the crystal structure of A. tumefaciens FliP has not been reported, homology modeling based on related structures can provide insights into critical domains. These predictions should be experimentally validated through the approaches outlined above.

How does environmental sensing affect FliP expression and flagellar assembly in the context of plant infection?

Environmental sensing plays a crucial role in regulating flagellar assembly and virulence factor expression in A. tumefaciens during plant infection:

Environmental Signals and Regulatory Networks:

  • Acidic Environment Response: Like the acid-induced T6SS , flagellar gene expression in A. tumefaciens may respond to acidic environments encountered during plant colonization. Expression analysis of fliP under different pH conditions can reveal this relationship.

  • Plant-Derived Signal Integration: A. tumefaciens responds to phenolic compounds released from wounded plant cells through the VirA/VirG two-component system . Potential cross-regulation between this system and flagellar gene expression should be investigated.

  • Nutrient Availability: The transition from soil environment to plant tissue involves changes in available nutrients, which may trigger adaptive responses in flagellar expression.

Experimental Design for Environmental Response Analysis:

To systematically assess how environmental signals affect FliP expression and flagellar assembly, researchers should:

  • Construct Reporter Fusions: Generate transcriptional (fliP promoter-gusA) and translational (FliP-FLAG) fusions to monitor expression levels.

  • Environmental Condition Matrix: Expose A. tumefaciens cultures to combinations of:

    • pH ranges (5.0-7.0)

    • Plant phenolics (acetosyringone concentrations 0-200 μM)

    • Carbon sources (glucose, sucrose, various opines)

    • Growth phases (exponential vs. stationary)

  • Expression Analysis: Measure fliP expression under each condition using:

    • qRT-PCR for transcript levels

    • Western blotting for protein levels

    • GUS activity assays for promoter activity

  • Correlation with Virulence: Compare expression patterns with virulence gene activation using the Arabidopsis seedling infection model to establish relationships between flagellar expression and pathogenicity.

This research could reveal how A. tumefaciens coordinates flagellar assembly with other virulence factors during the infection process, potentially identifying new targets for controlling plant diseases.

How can researchers distinguish between direct and indirect effects of FliP mutations on A. tumefaciens virulence?

Distinguishing between direct and indirect effects of FliP mutations on A. tumefaciens virulence requires a systematic analytical approach:

Experimental Strategy:

  • Genetic Complementation Analysis:

    • Generate precise fliP deletion mutants

    • Complement with wild-type fliP under native promoter control

    • Complement with fliP containing specific domain mutations

    • Compare virulence phenotypes across all strains

  • Phenotypic Dissection:

    • Separately measure each stage of the infection process:
      a) Chemotaxis toward plant signals
      b) Attachment to plant cells
      c) T-DNA transfer efficiency
      d) Integration into plant genome
      e) Tumor formation

  • Multi-omics Analysis:

    • Compare transcriptomes of wild-type and fliP mutants to identify altered gene expression patterns

    • Perform proteomics on membrane fractions to detect changes in protein complex formation

    • Analyze secretomes to determine effects on secretion system function

Analytical Framework for Causality Assessment:

Effect TypeExperimental EvidenceInterpretation
Direct effectPhenotype only affects motility; complementation restores only motilityFliP mutation directly impacts flagellar function without affecting other systems
Indirect regulatory effectGlobal changes in virulence gene expression; complementation restores expression patternsFliP mutation affects regulatory networks controlling multiple virulence systems
Indirect structural effectAltered membrane organization; affected localization of multiple protein complexesFliP mutation disrupts membrane microdomains that house multiple systems
Synthetic effectCombination of motility and secretion defects that cannot be separated geneticallyFliP functions in both flagellar assembly and another virulence-related process

This framework provides a structured approach to determine the mechanistic connections between FliP function and A. tumefaciens virulence.

What statistical approaches are most appropriate for analyzing A. tumefaciens motility data in FliP studies?

When analyzing A. tumefaciens motility data in FliP studies, researchers should employ appropriate statistical methods depending on the experimental design and data characteristics:

Recommended Statistical Approaches:

  • For Swimming Motility Assays (Continuous Data):

    • Normality Testing: Apply the Shapiro-Wilk test to determine if data follows a normal distribution

    • For Normal Distributions: Use one-way ANOVA followed by Tukey's HSD for multiple comparisons between wild-type, mutant, and complemented strains

    • For Non-Normal Distributions: Apply Kruskal-Wallis test followed by Dunn's post-hoc test

    • Effect Size Calculation: Report partial eta squared (η²) values, where:

      • Small effect: 0.01-0.059

      • Medium effect: 0.06-0.139

      • Large effect: ≥0.14

  • For Binary Phenotype Data:

    • Apply chi-square tests to determine significant differences in proportion of motile vs. non-motile cells

  • For Time-Course Experiments:

    • Use repeated measures ANOVA to account for temporal correlation

    • Consider mixed-effects models if incorporating multiple variables (strain, temperature, pH)

  • For Correlation Analysis:

    • Calculate Pearson's correlation coefficient (r) for normally distributed data or Spearman's rank correlation for non-normal data to assess relationships between motility and other phenotypes

Sample Size Determination:

To ensure adequate statistical power (conventionally 0.8 or higher), researchers should:

  • Conduct power analysis prior to experiments

  • Typically aim for a minimum of 3-5 biological replicates per condition

  • Include technical replicates (at least triplicate measurements)

Data Reporting Guidelines:

  • Report both p-values and effect sizes

  • Include appropriate graphical representations (box plots or violin plots preferred over bar graphs)

  • Clearly state statistical tests used, including post-hoc corrections for multiple comparisons

Following these statistical approaches will ensure robust and reproducible analysis of motility phenotypes in FliP studies.

How can researchers integrate data from different experimental approaches to build a comprehensive model of FliP function?

Building a comprehensive model of FliP function requires integrating diverse experimental data through systematic data integration strategies:

Data Integration Framework:

  • Multi-scale Data Collection and Analysis:

    • Molecular level: Protein-protein interactions, structural analysis

    • Cellular level: Protein localization, flagellar assembly

    • Organism level: Motility phenotypes, virulence assays

    • Host-pathogen level: Plant infection outcomes

  • Bayesian Network Modeling:

    • Construct probabilistic models that represent causal relationships between FliP structure, localization, and function

    • Incorporate prior knowledge about flagellar assembly

    • Update models as new experimental data becomes available

  • Systems Biology Approach:

    • Generate a comprehensive interaction network including:

      • Direct protein interactions with FliP

      • Genetic interactions identified through suppressor screens

      • Co-expression patterns across environmental conditions

      • Membrane microdomain co-localization data

Practical Implementation Strategy:

Data TypeIntegration MethodOutcome
Protein localization + membrane fractionationCorrelation analysisMap of FliP distribution within membrane microdomains
Mutagenesis + functional assaysStructure-function mappingCritical domains for FliP activity
Transcriptomics + proteomicsNetwork analysisRegulatory connections between flagellar and virulence systems
In vitro + in planta phenotypesHierarchical clusteringIdentification of phenotypic signatures

Visualization and Communication:

  • Develop interactive data visualization tools that allow exploration of integrated datasets

  • Create graphical models representing FliP interactions within the broader context of A. tumefaciens virulence

  • Establish standardized data repositories to facilitate comparison across studies

This integrated approach will provide a more complete understanding of how FliP contributes to A. tumefaciens biology and pathogenicity by connecting molecular mechanisms to cellular and organism-level phenotypes.

What emerging technologies could advance our understanding of FliP function in A. tumefaciens?

Several cutting-edge technologies show promise for revealing new insights into FliP function:

  • Cryo-Electron Tomography:

    • Enables visualization of the flagellar export apparatus in situ at near-atomic resolution

    • Could reveal the precise arrangement of FliP within the native membrane environment

    • Would complement existing fluorescence microscopy approaches that have shown spotty localization patterns for other membrane proteins

  • CRISPR-Cas9 Base Editing:

    • Allows precise single nucleotide modifications without double-strand breaks

    • Enables creation of subtle mutations to map critical residues in FliP

    • Can be applied to create comprehensive mutation libraries to screen for phenotypes

  • Proximity Labeling Proteomics:

    • Techniques like BioID or APEX2 fused to FliP can identify proximal proteins in vivo

    • Particularly valuable for identifying transient interactions within membrane microdomains

    • Could reveal connections between flagellar components and secretion systems

  • Super-Resolution Microscopy:

    • Methods like PALM, STORM, or structured illumination microscopy provide nanoscale resolution

    • Can resolve individual protein complexes within the bacterial membrane

    • Would build upon existing immunofluorescence approaches that have revealed protein localization patterns in A. tumefaciens

  • Single-Cell Transcriptomics:

    • Reveals cell-to-cell variability in gene expression

    • Could identify subpopulations with different flagellar expression states during infection

    • May reveal coordinated expression between flagellar genes and virulence factors

These technologies, when applied to study FliP in A. tumefaciens, have the potential to reveal fundamental mechanisms of flagellar assembly and its connection to bacterial pathogenesis.

How might understanding FliP function contribute to developing new strategies for plant transformation?

Understanding FliP function could lead to innovative approaches for enhancing plant transformation efficiency:

Potential Applications in Transformation Technology:

  • Engineered Motility for Improved Delivery:

    • Strategic modifications to FliP might enhance directional movement toward plant cells

    • Optimized flagellar function could increase the efficiency of bacterial delivery to target tissues

    • This could potentially improve transformation rates for recalcitrant plant species

  • Temporal Control of Flagellar Assembly:

    • Engineering inducible fliP expression systems could allow precise control over bacterial motility

    • This would enable a two-phase transformation approach:
      a) Enhanced motility phase for efficient tissue penetration
      b) Motility suppression phase to promote attachment and T-DNA transfer

  • Integration with Binary Vector Systems:

    • Current plant transformation relies on binary vector systems based on modified Ti plasmids

    • Understanding how flagellar function interfaces with T-DNA transfer could enable the development of more efficient vector systems

    • Potential for creating synthetic biology circuits that coordinate flagellar function with T-DNA transfer machinery

Experimental Approach to Developing Enhanced Transformation Systems:

StrategyExperimental DesignExpected Outcome
Flagellar optimizationEngineer FliP variants with enhanced stability or assembly efficiencyIncreased transformation efficiency in standard plant models
Regulatory circuit designCreate synthetic promoters linking flagellar expression to sensing of plant signalsContext-dependent motility activation
Co-optimization of motility and T4SSDual engineering of flagellar and T4SS componentsSynergistic improvements in transformation efficiency

These applications could significantly advance plant biotechnology by improving the precision and efficiency of Agrobacterium-mediated transformation, which remains the primary method for creating transgenic plants in research and agriculture .

What are the key unanswered questions about FliP function in A. tumefaciens?

Despite advances in our understanding of A. tumefaciens biology, several fundamental questions about FliP function remain unanswered:

  • Structural Organization: How is FliP oriented within the bacterial membrane, and what is the stoichiometry of FliP within the flagellar export apparatus? While membrane protein localization studies have revealed spotty patterns for other membrane proteins , the precise arrangement of FliP remains to be determined.

  • Regulatory Networks: What transcriptional and post-translational mechanisms regulate FliP expression and function during different stages of plant infection? The environmental sensing mechanisms that coordinate flagellar assembly with virulence activation are not fully understood.

  • Microdomain Association: Does FliP associate with specific membrane microdomains, and how does this affect its function? While other membrane proteins in A. tumefaciens have been shown to localize to detergent-resistant membranes , the specific localization of FliP has not been characterized.

  • Interspecies Variation: How does FliP function differ between A. tumefaciens strains with varying host ranges and virulence capabilities? Comparative studies across Agrobacterium species could reveal adaptations in flagellar systems that contribute to host specificity.

  • Temporal Dynamics: How does flagellar assembly and function change throughout the infection process? Time-course studies examining FliP localization and activity during different stages of plant colonization would provide valuable insights into the dynamic role of flagella during pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.