Recombinant Agrobacterium tumefaciens Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Atu2720; AGR_C_4930; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
mtgA
Target Protein Sequence
MDFRTLAKRIIMTLLALLILPYLLIPVYALPFIRPVSTLMLADLVTLQGYDRRWVPLEDI SPRLVQSVMMSEDGQFCFHGGVDWNQMQSVVSNALDGASTRGASTIPMQTAKNLFLWNGR SFLRKGLELPLAIAADFVWSKKRMMEIYLNVAEWGPGIYGIEAAAQHHFKIPAAKLSSRQ AALLAVSLPNPIDRVASKPGRGLQRLAGLIERRARASGGYVGCVLD
Uniprot No.

Target Background

Function
Recombinant *Agrobacterium tumefaciens* Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: atu:Atu2720

STRING: 176299.Atu2720

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of MtgA in bacterial peptidoglycan synthesis?

MtgA functions as a glycosyltransferase that catalyzes the polymerization of glycan strands during peptidoglycan synthesis. In the peptidoglycan synthesis pathway, after the flippase MurJ protein translocates lipid II from the cytoplasm to the periplasm, glycosyltransferases like MtgA add the disaccharide-pentapeptide from lipid II to nascent glycan strands . This polymerization is a critical step in cell wall formation, providing structural integrity to the bacterial cell. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase activities, MtgA is monofunctional, focusing solely on glycosyl transfer reactions.

How does peptidoglycan synthesis in Agrobacterium tumefaciens differ from model organisms like Escherichia coli?

Agrobacterium tumefaciens exhibits distinctive peptidoglycan synthesis patterns that differ significantly from E. coli:

  • Agrobacterium tumefaciens elongates from the growth pole (GP), with new peptidoglycan incorporation occurring specifically at this location .

  • Unlike E. coli, Agrobacterium lacks MreB and most components of the elongasome complex, suggesting the existence of a specialized polar growth machinery .

  • Agrobacterium peptidoglycan is enriched with 3-3 peptide bonds (50% in Agrobacterium versus 10% in E. coli), indicating predominant LD-transpeptidase activity rather than DD-transpeptidase activity .

  • The genome of Agrobacterium contains an unusual abundance of open reading frames for LD-transpeptidases, with at least one (Atu0845) localizing at the growth pole alongside Agrobacterium PBP1a .

What expression systems are commonly used for recombinant production of bacterial transglycosylases?

Based on established protocols for similar enzymes, E. coli expression systems are typically preferred for recombinant production of bacterial transglycosylases. For instance, recombinant monofunctional biosynthetic peptidoglycan transglycosylase from Shewanella amazonensis is expressed in E. coli with an N-terminal His-tag . This approach allows for:

  • High-yield expression of soluble protein

  • Simplified purification through affinity chromatography

  • Potential for scaling up production for crystallization studies

  • Expression of the full-length protein (amino acids 1-245 for the Shewanella homolog)

What are the optimal conditions for assessing the enzymatic activity of purified recombinant MtgA?

Optimal enzymatic activity assessment for recombinant MtgA typically involves:

Buffer conditions:

ParameterOptimal RangeNotes
pH7.5-8.0Tris/PBS-based buffers preferred
Salt concentration100-150 mM NaClHigher concentrations may inhibit activity
Divalent cations5-10 mM Mg²⁺Essential cofactor for catalytic activity
Reducing agents1-5 mM DTTPrevents oxidation of catalytic cysteines
Temperature25-30°CReflects natural growth temperature of A. tumefaciens

Fluorescent lipid II analogs are commonly used as substrates, with activity monitored through HPLC or SDS-PAGE analysis of reaction products. Care must be taken to ensure that His-tag fusion does not interfere with enzymatic activity; in some cases, tag removal may be necessary for reliable activity measurements.

How does the subcellular localization of MtgA contribute to the polar growth pattern observed in Agrobacterium tumefaciens?

In Agrobacterium tumefaciens, peptidoglycan synthesis occurs at the growth pole, as evidenced by pulse-labeling experiments with nitrobenzofurazanyl-amino-D-alanine (NADA) . The localization pattern of MtgA is likely coordinated with other cell wall synthesis proteins:

  • Agrobacterium ParB (fused to mCherry) is visible as a distinct focus at the old cell pole in early cell cycle stages .

  • The putative LD-transpeptidase Atu0845 localizes at the growth pole alongside Agrobacterium PBP1a .

  • While specific localization data for MtgA is not provided in the available search results, it likely follows similar polar localization patterns as other peptidoglycan synthesis enzymes in this organism.

The polar localization of these proteins collectively establishes a growth machinery that directs cell wall synthesis to the pole, rather than the lateral walls as seen in rod-shaped bacteria that utilize MreB. This specialized growth pattern is likely essential for the characteristic growth mode of A. tumefaciens.

What structural features of Agrobacterium tumefaciens MtgA might explain its function in polar growth?

While specific structural data for Agrobacterium tumefaciens MtgA is not available in the search results, comparative analysis with homologous proteins suggests several key structural features that might be important for its function:

  • Catalytic domain architecture: Likely contains a conserved transglycosylase fold with essential catalytic residues for glycosyl transfer reactions.

  • Membrane association regions: May possess hydrophobic or amphipathic helices that facilitate association with the cytoplasmic membrane where peptidoglycan precursors are located.

  • Protein-protein interaction domains: Potential interaction interfaces with LD-transpeptidases or other components of the polar growth machinery unique to Agrobacterium.

  • Localization signals: Possible specific sequences or structural elements that direct the protein to the growth pole rather than distributing throughout the cell envelope.

Advanced structural studies using X-ray crystallography or cryo-EM would be necessary to definitively identify these features and understand their functional significance.

What purification strategies yield the highest activity of recombinant MtgA?

Based on protocols for similar proteins, the following purification strategy is recommended for recombinant MtgA:

  • Expression optimization:

    • Expression in E. coli BL21(DE3) or similar strains

    • Induction at lower temperatures (16-20°C) to enhance solubility

    • Consider codon optimization for the A. tumefaciens sequence

  • Initial purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Elution with imidazole gradient (50-250 mM)

    • Buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and impurities

    • Ion exchange chromatography for additional purity if needed

  • Storage considerations:

    • Addition of 6% trehalose as a stabilizing agent

    • pH 8.0 buffer conditions

    • Aliquoting and flash-freezing to prevent freeze-thaw cycles

    • Storage at -80°C for long-term preservation

How can researchers assess the impact of mutations in MtgA on cell wall synthesis and bacterial growth?

Comprehensive assessment of MtgA mutations requires a multi-faceted approach:

  • In vitro enzymatic assays:

    • Compare transglycosylase activity of wild-type and mutant proteins using fluorescent lipid II substrates

    • Determine kinetic parameters (Km, Vmax) to quantify effects on catalytic efficiency

    • Assess substrate specificity alterations

  • Complementation studies:

    • Generate MtgA deletion strains in A. tumefaciens

    • Introduce wild-type or mutant alleles on expression plasmids

    • Analyze growth rates, cell morphology, and drug sensitivity

  • Cell wall composition analysis:

    • Isolate peptidoglycan and analyze muropeptide composition by HPLC

    • Quantify changes in glycan strand length and cross-linking patterns

    • Compare 3-3 vs. 4-4 cross-link ratios, which are distinctively high (50%) in A. tumefaciens

  • Microscopy-based approaches:

    • Fluorescent D-amino acid labeling to visualize sites of active peptidoglycan synthesis

    • Immunolocalization of wild-type and mutant MtgA proteins

    • Time-lapse microscopy to assess effects on growth pole dynamics

What strategies can be employed to develop specific inhibitors of Agrobacterium tumefaciens MtgA?

Developing specific inhibitors of A. tumefaciens MtgA would require:

  • Structure-based drug design:

    • Obtain crystal structure of A. tumefaciens MtgA

    • Identify unique structural features compared to human glycosyltransferases

    • In silico screening of compound libraries targeting the active site

  • High-throughput screening approaches:

    • Develop fluorescence-based assays suitable for 96/384-well format

    • Screen natural product or synthetic compound libraries

    • Validate hits with secondary biochemical assays

  • Specificity assessment:

    • Compare inhibition of A. tumefaciens MtgA vs. homologs from other bacteria

    • Evaluate effects on human glycosyltransferases to predict toxicity

    • Test growth inhibition specificity against various bacterial species

  • Mechanism of action studies:

    • Determine whether inhibitors are competitive, non-competitive, or uncompetitive

    • Identify binding sites through co-crystallization or mutagenesis

    • Assess effects on peptidoglycan structure in vivo

How do researchers resolve contradictory findings regarding MtgA function across different bacterial species?

When facing contradictory findings across bacterial species, researchers should:

  • Perform comprehensive comparative genomics:

    • Analyze synteny and genetic context of mtgA in different species

    • Identify co-evolved genes that might explain functional differences

    • Construct phylogenetic trees to understand evolutionary relationships

  • Conduct controlled cross-species experiments:

    • Express mtgA genes from different species in a common host

    • Standardize experimental conditions to eliminate methodological variations

    • Perform side-by-side biochemical characterization

  • Consider biological context:

    • Evaluate differences in growth patterns (e.g., polar growth in A. tumefaciens vs. lateral growth in E. coli)

    • Analyze cell wall composition variations (e.g., 3-3 vs. 4-4 cross-links)

    • Assess redundancy with other transglycosylases that might mask phenotypes

  • Develop species-specific assays:

    • Design experiments that account for the unique growth patterns of each species

    • Use species-appropriate growth conditions and stress challenges

    • Consider protein-protein interactions specific to each organism

What bioinformatic approaches can identify novel functional domains in Agrobacterium tumefaciens MtgA?

Advanced bioinformatic analyses for MtgA characterization include:

  • Sequence-based analyses:

    • Multiple sequence alignments with diverse bacterial transglycosylases

    • Hidden Markov Model searches for novel conserved motifs

    • Analysis of covariation patterns to identify functionally linked residues

  • Structural prediction approaches:

    • AlphaFold2 or RoseTTAFold modeling of full-length protein

    • Molecular dynamics simulations to identify flexible regions

    • Protein-protein interaction surface prediction

  • Evolutionary analyses:

    • Identification of positively selected residues that may confer specialized function

    • Analysis of gene duplication and divergence patterns within Rhizobiaceae

    • Ancestral sequence reconstruction to understand evolutionary trajectories

  • Integrated multi-omics:

    • Correlation of expression patterns with other cell wall synthesis genes

    • Identification of potential regulatory elements in the promoter region

    • Prediction of post-translational modifications that might regulate activity

How might understanding MtgA function contribute to development of new biotechnological tools?

The unique properties of Agrobacterium tumefaciens MtgA present several opportunities for biotechnological applications:

  • Synthetic biology chassis development:

    • Engineering growth pattern control in bacterial cell factories

    • Creating bacteria with customized cell shapes for specialized functions

    • Developing strains with enhanced stress resistance through cell wall modifications

  • Enzyme engineering applications:

    • Creation of chimeric transglycosylases with novel substrate specificities

    • Development of engineered enzymes for chemoenzymatic synthesis of glycopolymers

    • Design of reporter systems based on transglycosylase activity

  • Agricultural biotechnology:

    • Improved understanding of Agrobacterium-plant interactions

    • Engineering of Agrobacterium for enhanced transformation efficiency

    • Development of strategies to control Agrobacterium infections in susceptible crops

  • Antimicrobial development:

    • Identification of novel transglycosylase inhibitors with species-specific activity

    • Rational design of combination therapies targeting multiple cell wall synthesis steps

    • Creation of peptidoglycan-remodeling enzymes as antimicrobial agents

What are the current technical limitations in studying recombinant MtgA, and how might they be overcome?

Current technical challenges in MtgA research include:

Table: Technical Limitations and Potential Solutions

LimitationChallengePotential Solution
Protein stabilityRecombinant MtgA may lose activity during purification or storageUse stabilizing additives like trehalose (6%) ; optimize buffer conditions; consider fusion partners
Membrane associationNative MtgA interacts with membrane, complicating in vitro studiesDevelop nanodisc or liposome reconstitution systems; use detergent-compatible assays
Complex formationMtgA may function in multi-protein complexesCo-expression with interaction partners; pull-down assays to identify complex components
Substrate availabilityLipid II substrates are complex to synthesizeDevelop simplified substrate analogs; establish collaboration with specialized lipid synthesis laboratories
In vivo activity assessmentDifficult to distinguish MtgA activity from other transglycosylasesGenerate clean deletion strains; use chemical genetics with specific inhibitors; develop activity-based probes
Structural determinationMembrane association complicates crystallizationUse soluble domain constructs; explore cryo-EM alternatives; try lipid cubic phase crystallization

Overcoming these limitations will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and advanced imaging techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.