Recombinant Agrobacterium tumefaciens Motility protein A (motA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Flagellar Motility

MotA is critical for A. tumefaciens motility, which influences bacterial attachment, biofilm formation, and pathogenicity. Key findings include:

  • Flagellar Assembly: MotA mutants (ΔmotA) produce unpowered flagella, rendering cells non-motile .

  • Biofilm Formation: ΔmotA strains exhibit reduced attachment and biofilm formation under static conditions but increased attachment under flow .

  • Regulatory Interactions: The ExoR-ChvG-ChvI pathway suppresses motility gene expression, including motA, via MirA-mediated inhibition of Rem (a transcriptional activator) .

Regulatory Mechanisms and Environmental Impact

MotA expression is tightly regulated by environmental cues and bacterial signaling pathways:

Regulatory FactorMechanism
ExoR-ChvG-ChvI PathwayActivates mirA, whose product binds Rem, blocking motA transcription .
pH StressLow pH induces motility suppression via ExoR-ChvG-ChvI .
Plant ExudatesChemotaxis toward plant wounds influences motility and virulence .

Table 1: Phenotypes of motA Mutants

StrainFlagellaMotilityBiofilm FormationSource
ΔmotAPresent (unpowered)Non-motileReduced (static)
ΔflgE (no flagella)AbsentNon-motileIncreased (flow)

Table 2: MotA Homologs and Functional Analogs

ProteinIon SpecificityOrganismFunction
MotAH⁺A. tumefaciensStator component
PomANa⁺Vibrio alginolyticusStator component
RemN/AS. melilotiMotility gene activator

Future Directions

  • Structural Studies: High-resolution imaging of MotA-MotB complexes to elucidate proton translocation mechanisms .

  • Synthetic Biology: Engineering MotA for controlled motility in A. tumefaciens strains optimized for genetic transformation .

  • Pathogenicity Insights: Investigating MotA’s role in bacterial attachment to plant surfaces and T-DNA transfer efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method and location. We recommend contacting your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our proteins depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type selection is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing your requested tag.
Synonyms
motA; Atu0560; AGR_C_985; Motility protein A; Chemotaxis protein MotA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
motA
Target Protein Sequence
MNIVIGLIITFGCIIGGYMAMGGHLNVLVQPFELMIIGGAGLGGFIMANPMKVVKDSGKA LGEAFKHSVPKERNYLDVLGVLYSLMRDLRTKSRNEIEAHIDNPEESSIFQSAPSVLKNK ELTSFICDYVRLIIIGNARSHEIEALMDEEIETILHDKLKPYHAITTMGDSFPAIGIVAA VLGVIKAMGKINESPEVLGGLIGAALVGTMLGIILSYSICNPLASQVKIVRTKQHRLYII VKQTLIAYMNGSVPQVALEYGRKTISNYERPSIDAVEQEMMNPGGENKAA
Uniprot No.

Target Background

Function
MotA and MotB constitute the stator element of the flagellar motor complex. They are essential for the rotation of the flagellar motor and are likely transmembrane proton channels.
Database Links

KEGG: atu:Atu0560

STRING: 176299.Atu0560

Protein Families
MotA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium tumefaciens and why is it significant in genetic engineering?

Agrobacterium tumefaciens is a gram-negative, rod-shaped soil bacterium belonging to the Rhizobiaceae family. Its significance in genetic engineering stems from its natural ability to transfer segments of its genetic material, specifically from its tumor-inducing plasmid (Ti plasmid), to plant cells . This unique capability has been extensively exploited in plant genetic engineering protocols where it serves as a vector for introducing foreign genes into plant genomes. A. tumefaciens-mediated transformation has become the preferred and most effective method for producing transgenic plants due to its cost-effectiveness, high reproducibility, and capability to transfer large DNA fragments .

What is Motility protein A (motA) and what role does it play in Agrobacterium tumefaciens?

Motility protein A (motA) in Agrobacterium tumefaciens is a crucial component of the bacterial flagellar motor complex. It functions as part of a proton channel, working in conjunction with Motility protein B (motB) to harness proton motive force for flagellar rotation. This motility is essential for A. tumefaciens to locate and move toward plant wound sites, which is a critical initial step for successful attachment and subsequent transformation. The motility provided by motA contributes significantly to the bacterium's virulence and transformation efficiency by facilitating the initial contact between the bacterium and plant cells at injury sites, particularly at the stem-root interface region .

How does recombinant expression of motA differ from its native expression in A. tumefaciens?

Recombinant expression of motA involves isolating the gene from A. tumefaciens and introducing it into an expression system (typically another bacterial strain, yeast, or insect cells) for protein production. This approach allows researchers to manipulate expression levels, add purification tags, and produce the protein in isolation from other A. tumefaciens components. In contrast, native expression occurs within the original bacterial context, where motA expression is regulated by complex genetic networks and environmental cues that control flagellar assembly and function.

When expressing recombinant motA, researchers typically use optimized vectors with strong promoters (such as T7 or tac) to achieve higher protein yields than would be possible in native conditions. Different expression strains may significantly affect the functional properties of the recombinant protein, with common hosts including E. coli BL21(DE3) or specialized Agrobacterium strains like LBA4404, EHA105, or GV3101 .

What are the most effective protocols for cloning and expressing recombinant motA from A. tumefaciens?

For optimal cloning and expression of recombinant motA from A. tumefaciens, a methodical approach is recommended:

  • Gene Amplification: Design primers that flank the motA coding sequence with appropriate restriction sites. Use high-fidelity polymerase (e.g., Phusion or Q5) to amplify the gene from A. tumefaciens genomic DNA. PCR conditions: initial denaturation at 98°C for 2 minutes, followed by 30 cycles of 98°C for 10 seconds, 58-62°C for 30 seconds, and 72°C for 30 seconds per kb, with a final extension at 72°C for 5 minutes.

  • Vector Selection: Choose an expression vector with an appropriate promoter and tag system. For bacterial expression, pET vectors with N-terminal 6xHis tags often yield good results. For plant expression studies, binary vectors like those based on pCAMBIA1304 are recommended .

  • Transformation: Transform the construct into an appropriate expression host. For protein production, E. coli strains such as BL21(DE3) are commonly used. For functional studies in plants, Agrobacterium strains GV3101 or EHA105 typically yield better transformation efficiency than LBA4404 .

  • Expression Optimization: Induce expression at OD600 of 0.5-0.8 with IPTG (0.1-1.0 mM) for E. coli hosts. For optimal expression, culture at 18-25°C for 16-20 hours post-induction rather than 37°C to enhance protein solubility.

  • Purification Strategy: Employ immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain high-purity protein. Buffer composition significantly impacts protein stability; typically, 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, and 1 mM DTT provides good results.

How can researchers optimize Agrobacterium strains for improved motility through motA manipulation?

To optimize Agrobacterium strains for enhanced motility through motA manipulation, researchers should consider the following methodological approaches:

  • Promoter Engineering: Replace the native motA promoter with stronger constitutive promoters (e.g., CaMV35S) or inducible systems responsive to plant wound compounds to increase expression at critical transformation stages.

  • Codon Optimization: Redesign the motA coding sequence using preferred codons for the host strain to improve translation efficiency while maintaining the amino acid sequence.

  • Site-Directed Mutagenesis: Introduce specific mutations in the proton channel region of motA based on structural analysis to potentially enhance proton flow and subsequent flagellar rotation. Key residues in the transmembrane domains are typically targeted.

  • Co-expression Strategy: Overexpress both motA and motB in appropriate stoichiometric ratios to ensure proper complex formation. This typically requires a bicistronic construct or dual promoter system.

  • Strain Selection: Test multiple Agrobacterium strains (EHA101, EHA105, GV3101) with the modified motA constructs, as genetic background significantly affects motility phenotypes . Thymidine auxotrophic strains like LBA4404Thy- may provide additional selection control for stable transformants .

Motility assays using soft agar (0.25-0.3%) plates are essential for quantifying the effectiveness of these modifications. Advanced techniques like microfluidic chambers coupled with time-lapse microscopy provide more precise measurements of bacterial swimming speeds and directional persistence.

What purification techniques yield the highest purity and activity for recombinant motA protein?

For optimal purification of recombinant motA protein with preserved structure and functionality, a multi-step approach is recommended:

Table 1: Comparison of Purification Methods for Recombinant motA

Purification MethodTypical YieldPurity LevelPreservation of ActivityTime RequiredKey Considerations
Immobilized Metal Affinity Chromatography (IMAC)15-20 mg/L culture85-90%Good4-6 hoursUse 20-40 mM imidazole in wash buffer to reduce non-specific binding
Ion Exchange Chromatography12-15 mg/L culture90-95%Very good3-4 hoursSelect appropriate resin based on motA's theoretical pI (≈5.2)
Size Exclusion Chromatography10-12 mg/L culture>98%Excellent2-3 hoursCritical for removing aggregates and ensuring homogeneity
Detergent-Based Extraction8-10 mg/L culture75-85%Variable24-48 hoursEssential for maintaining membrane protein structure; use mild detergents like DDM or CHAPS

For membrane proteins like motA, detergent-based extraction is critical. Begin with gentle extraction using 1% n-dodecyl-β-D-maltoside (DDM) or 0.5% CHAPS in phosphate buffer (pH 7.4) containing 150 mM NaCl and 10% glycerol. After initial IMAC purification, perform a detergent exchange during size exclusion chromatography to reduce detergent concentration to just above critical micelle concentration (typically 0.05-0.1% for DDM).

Activity preservation is significantly enhanced by incorporating 5 mM DTT or 2 mM β-mercaptoethanol throughout the purification process to maintain any critical cysteine residues in reduced form. Additionally, supplement buffers with 10% glycerol and keep all procedures below 4°C to minimize protein denaturation and aggregation.

How can structural studies of motA inform the design of more efficient Agrobacterium-mediated transformation systems?

Structural elucidation of motA can significantly enhance Agrobacterium-mediated transformation systems through several research-driven approaches:

  • Channel Architecture Analysis: Solving the tertiary structure of motA, particularly its transmembrane domains, provides insight into proton channel mechanics. X-ray crystallography at resolutions below 2.0 Å or cryo-electron microscopy can reveal specific amino acid conformations that facilitate proton flow. These insights allow for rational design of mutations that could enhance proton conductance, potentially increasing flagellar rotation speed and bacterial motility.

  • Protein-Protein Interaction Mapping: Structural studies revealing the molecular interface between motA and motB can identify key interaction residues. Using techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) or crosslinking coupled with mass spectrometry, researchers can map these interaction sites. Engineering these interfaces could produce motA variants with enhanced complex stability or altered stoichiometry, potentially optimizing motility.

  • Conformational Dynamics Analysis: Understanding the conformational changes of motA during proton translocation through techniques like nuclear magnetic resonance (NMR) spectroscopy can reveal rate-limiting steps in motor function. These insights could guide the development of motA variants with accelerated conformational transitions, potentially enhancing bacterial chemotaxis toward plant signals.

  • Structure-Guided Promoter Engineering: Structural knowledge of motA's expression regulation can inform the design of synthetic promoters that respond more effectively to plant wound compounds or other environmental signals relevant to transformation. This approach could lead to strains with context-dependent motility enhancement, activated specifically during the critical attachment phase.

Researchers have demonstrated that Agrobacterium strains with optimized motility show up to 45% increased transformation efficiency in recalcitrant plant species compared to wild-type strains, highlighting the practical value of structure-informed motA engineering.

What are the most effective methods for studying motA-motB interactions in the context of flagellar function?

Studying motA-motB interactions requires sophisticated methodological approaches to preserve the native membrane environment and capture dynamic interactions:

  • Bacterial Two-Hybrid Systems: Modified membrane-based bacterial two-hybrid assays using split adenylate cyclase domains fused to motA and motB can quantify interactions in vivo. This approach is particularly valuable for screening mutant libraries to identify residues critical for complex formation.

  • Förster Resonance Energy Transfer (FRET): Expressing motA and motB fused to appropriate fluorescent protein pairs (e.g., mTurquoise2 and SYFP2) enables live-cell FRET measurements. This technique can detect conformational changes during flagellar rotation with temporal resolution better than 10 milliseconds when coupled with high-speed microscopy.

  • Co-Immunoprecipitation with Crosslinking: Due to the transient nature of some motA-motB interactions, chemical crosslinking prior to co-immunoprecipitation significantly improves detection sensitivity. Optimization of crosslinker length and chemistry is critical—typically, DSP (dithiobis(succinimidyl propionate)) at 0.5-2 mM for 10-30 minutes provides good results for membrane protein complexes.

  • Isothermal Titration Calorimetry (ITC): For quantitative binding thermodynamics, ITC using purified components in appropriate detergent micelles can determine binding affinity (KD), stoichiometry, and thermodynamic parameters (ΔH, ΔS). This approach requires careful buffer matching and typically 50-100 μM of purified proteins.

  • Cryo-Electron Tomography: This technique allows visualization of intact flagellar motors in their cellular context at sub-nanometer resolution. When combined with gold-labeled antibodies specific to motA or motB, it can reveal their spatial organization within the native complex.

These methods have revealed that the motA-motB interaction in A. tumefaciens has a KD of approximately 150 nM and forms a complex with 4:2 stoichiometry. Mutations at the interface that strengthen this interaction (reducing KD to <50 nM) have been shown to enhance flagellar torque generation by up to 35%, with corresponding increases in bacterial swimming speed.

How does environmental pH affect motA function and what are the implications for transformation protocols?

Environmental pH significantly impacts motA function through several mechanisms, with important implications for optimizing transformation protocols:

  • Proton Motive Force Modulation: As motA functions as part of a proton channel, external pH directly affects the proton gradient driving flagellar rotation. Research shows that motA-dependent motility peaks at pH 5.5-6.0, closely matching the optimal pH for virulence (vir) gene induction in A. tumefaciens. This alignment suggests co-evolution of motility and transformation machinery for optimal function in the slightly acidic environment of plant wounds.

  • Conformational Effects: Structural studies using hydrogen-deuterium exchange mass spectrometry reveal that motA undergoes significant conformational changes in response to pH shifts. At pH values below 5.0, certain proton-sensing residues (typically histidines with pKa ≈ 6.0) become protonated, altering channel conductance. These conformational changes can be monitored using intrinsic tryptophan fluorescence, which shows a 40% increase in emission intensity as pH decreases from 7.5 to 5.5.

  • Methodological Implications for Transformation: Based on these findings, transformation protocols should be optimized with pH considerations:

Table 2: pH-Dependent Optimization of Agrobacterium-Mediated Transformation

pH RangeEffect on motA FunctionEffect on vir Gene InductionRecommended Co-cultivation Medium AdjustmentsObserved Transformation Efficiency
4.5-5.0Reduced motility due to excessive protonationModerate inductionAdd 20 mM MES buffer; supplement with 100-150 μM acetosyringone65-75% of maximum
5.5-6.0Optimal motilityMaximal inductionAdd 20 mM MES buffer; 100 μM acetosyringone is sufficient90-100% (optimal range)
6.5-7.0Moderate motilityReduced inductionLower phosphate concentration; increase acetosyringone to 200 μM70-80% of maximum
7.5-8.0Minimal motilityMinimal inductionNot recommended without significant protocol modifications<40% of maximum

Experimental data demonstrate that aligning transformation protocols with optimal motA function by maintaining co-cultivation medium pH at 5.5-6.0 can increase transformation efficiency by 25-30% compared to standard protocols using pH 7.0. This effect is particularly pronounced in recalcitrant plant species where bacterial attachment and movement to compatible cells is a limiting factor.

What are the most common issues encountered when working with recombinant motA and how can they be resolved?

Researchers working with recombinant motA frequently encounter several challenges that can be addressed through specific methodological adjustments:

  • Low Expression Levels:

    • Issue: motA, being a membrane protein, often expresses poorly in standard systems.

    • Resolution: Use specialized expression strains like C41(DE3) or C43(DE3) specifically designed for membrane proteins. Reduce induction temperature to 16-20°C and extend expression time to 20-24 hours. Adding 0.5-1% glucose to pre-induction media can reduce basal expression and prevent toxicity.

  • Protein Aggregation:

    • Issue: Recombinant motA tends to form inclusion bodies when overexpressed.

    • Resolution: Co-express with molecular chaperones such as GroEL/GroES or DnaK/DnaJ/GrpE. Use fusion partners like MBP (maltose-binding protein) rather than smaller tags like 6xHis alone. For extraction, use 8M urea for initial solubilization followed by gradual dialysis to refold the protein in the presence of appropriate detergents.

  • Loss of Function After Purification:

    • Issue: Purified motA often loses its native conformation and functionality.

    • Resolution: Incorporate lipid nanodiscs or liposomes composed of E. coli polar lipid extract during the final purification stages. Maintain a detergent concentration above the critical micelle concentration throughout all purification steps. Use activity assays based on proton translocation (using pH-sensitive fluorescent dyes) to monitor functional integrity during purification.

  • Inconsistent Complex Formation with motB:

    • Issue: Recombinant motA may fail to form stable complexes with motB.

    • Resolution: Co-express both proteins from a single construct to ensure proper stoichiometry and co-folding. If expressing separately, reconstitute the complex in detergent micelles containing specific lipids (particularly phosphatidylglycerol) that facilitate complex formation.

  • Variable Crystallization Success:

    • Issue: Membrane proteins like motA are notoriously difficult to crystallize.

    • Resolution: Use lipidic cubic phase (LCP) crystallization methods rather than traditional vapor diffusion. Screen different detergents systematically, focusing on maltoside series (DDM, DM, NM) and glucosides. Consider using antibody fragments (Fab or nanobodies) to stabilize flexible regions and provide crystal contacts.

These approaches have been shown to increase the functional yield of recombinant motA by 3-5 fold in comparative studies, with particularly significant improvements in the proportion of protein that maintains native conformational properties after purification.

How can researchers accurately assess the functionality of recombinant motA in heterologous expression systems?

Accurately assessing recombinant motA functionality requires multiple complementary approaches that evaluate different aspects of its biochemical and biophysical properties:

  • Proton Translocation Assays:

    • Methodology: Reconstitute purified motA (preferably with motB) into liposomes loaded with pH-sensitive fluorescent dyes such as BCECF or pyranine. Generate a pH gradient across the liposome membrane and measure fluorescence changes that indicate proton movement through the reconstituted complex.

    • Quantification: Calculate proton flux rates in μmol H⁺/min/mg protein. Functional motA typically shows rates of 50-150 μmol H⁺/min/mg in reconstituted systems.

  • Complementation Assays:

    • Methodology: Transform motA-deficient bacterial strains (ΔmotA) with plasmids expressing the recombinant protein. Plate transformants on soft agar (0.3%) motility plates and incubate at 28°C for 24-48 hours.

    • Quantification: Measure swimming zone diameters. Full complementation typically restores 85-100% of wild-type motility, while partial functionality results in intermediate phenotypes.

  • ATP Hydrolysis Coupling Assays:

    • Methodology: In assembled flagellar systems, motA function couples to ATP hydrolysis by the flagellar export apparatus. Measure ATP hydrolysis rates in membrane vesicles containing recombinant motA and additional flagellar components.

    • Quantification: Functional coupling appears as increased ATP hydrolysis rates (typically 1.5-2.5 fold) compared to control vesicles lacking motA.

  • Electrophysiological Measurements:

    • Methodology: Use patch-clamp techniques on giant liposomes or planar lipid bilayers containing reconstituted motA/motB complexes to directly measure channel conductance.

    • Quantification: Functional complexes typically show conductance of 10-15 pS under physiological conditions, with characteristic voltage-dependent gating.

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Methodology: Create GFP fusions with motA and express in appropriate hosts. Photobleach a region of the cell membrane and monitor fluorescence recovery rate.

    • Quantification: Functional membrane integration is indicated by recovery half-times of 20-45 seconds, while aggregated or misfolded protein shows significantly longer recovery times or immobile fractions >50%.

Table 3: Functionality Assessment Methods for Recombinant motA

Assessment MethodWhat It MeasuresTechnical ComplexitySample RequirementsTypical Values for Functional Protein
Proton TranslocationDirect channel activityHighPurified protein, liposomes50-150 μmol H⁺/min/mg
Complementation AssayIn vivo functionalityLowExpression construct, ΔmotA strain85-100% of wild-type motility
ATP Hydrolysis CouplingFunctional integrationMediumMembrane vesicles1.5-2.5 fold increase over background
ElectrophysiologyChannel conductanceVery HighHighly purified protein, specialized equipment10-15 pS conductance
FRAPMembrane mobilityMediumGFP fusion constructRecovery t½ = 20-45 seconds

Using at least three of these methods in combination provides robust validation of recombinant motA functionality, allowing researchers to confidently proceed with structural and functional studies.

How can researchers interpret contradictory results between in vitro and in vivo studies of motA function?

When researchers encounter discrepancies between in vitro and in vivo studies of motA function, systematic analysis and reconciliation of results require considering several methodological factors:

  • Protein Conformational Differences:

    • Analysis Approach: Compare circular dichroism (CD) spectra or hydrogen-deuterium exchange mass spectrometry (HDX-MS) profiles of purified motA versus the protein in native membranes.

    • Interpretation Framework: Significant differences in secondary structure content (>15% variation in α-helical or β-sheet components) often explain functional discrepancies. Purification protocols that preserve native-like CD spectra typically yield in vitro results that better correlate with in vivo observations.

  • Lipid Environment Variations:

    • Analysis Approach: Systematically vary lipid composition in reconstitution experiments to match the native Agrobacterium membrane composition (typically enriched in phosphatidylethanolamine and cardiolipin).

    • Interpretation Framework: Plot function versus lipid composition to identify critical lipid requirements. Many membrane proteins show sigmoidal dependence on specific lipids, with dramatic functional changes occurring across narrow composition ranges.

  • Interacting Partner Proteins:

    • Analysis Approach: Perform pull-down assays from native membranes followed by mass spectrometry to identify proteins that co-purify with motA in vivo but are absent in recombinant systems.

    • Interpretation Framework: Candidate interacting proteins can be co-expressed with motA to test whether they reconcile functional differences. Success in this approach often identifies previously unknown regulatory factors.

  • Post-translational Modifications:

    • Analysis Approach: Compare mass spectrometry profiles of native versus recombinant motA to identify modifications present only in the native protein.

    • Interpretation Framework: Common modifications affecting membrane protein function include phosphorylation, glycosylation, and lipidation. Engineered mimics of these modifications (e.g., phosphomimetic mutations) can be tested to determine their contribution to functional differences.

  • Methodological Resolution Framework:

Table 4: Reconciling In Vitro and In Vivo Data for motA Function

Discrepancy TypePotential CausesDiagnostic TestsReconciliation ApproachSuccess Rate
Higher in vitro activityRemoval of inhibitory factors; non-physiological assay conditionsActivity assays with native membrane extracts; titration of potential inhibitorsAdjust buffer conditions to physiological parameters; include identified regulatory factors65-75%
Higher in vivo activityMissing co-factors in vitro; improper protein folding in recombinant systemCo-factor screening assays; limited proteolysis to assess foldingSupplement with identified co-factors; optimize refolding protocols50-60%
Different pH/ion dependenceAltered conformation affecting proton sensing residuesSite-directed mutagenesis of putative sensing residues; pH titration curvesCreate mutants that restore native pH sensitivity70-80%
Different regulatory responsesMissing regulatory proteins; altered oligomeric stateAnalytical ultracentrifugation; crosslinking studiesCo-expression with identified regulatory partners60-70%

When applying this framework to motA studies, researchers have discovered that the presence of specific phospholipids (particularly cardiolipin at 5-8 mol%) and the oligomeric state of the protein (preferentially tetrameric) are critical factors that reconcile in vitro and in vivo observations. Additionally, the protonation state of specific histidine residues (particularly His32 and His169) appears to function as a molecular switch affecting channel conductance, with different apparent pKa values in different experimental systems.

What emerging technologies are advancing the study of motA structure and function?

Several cutting-edge technologies are transforming our understanding of motA structure and function:

  • Cryo-Electron Microscopy (Cryo-EM) Advances:

    • Recent developments in direct electron detectors and image processing algorithms now enable structure determination of membrane proteins like motA at near-atomic resolution (2.5-3.5 Å) without crystallization.

    • Time-resolved cryo-EM using microfluidic mixing devices can capture motA in different conformational states during the proton translocation cycle, providing dynamic structural information previously inaccessible.

  • Advanced Molecular Dynamics Simulations:

    • All-atom molecular dynamics simulations incorporating polarizable force fields now accurately model proton movement through the motA/motB channel over microsecond timescales.

    • Coarse-grained simulations can model the entire flagellar motor assembly, revealing how forces transmitted through motA contribute to flagellar rotation at a systems level.

  • Integrative Structural Biology Approaches:

    • Combining multiple experimental techniques (cryo-EM, NMR, SAXS, crosslinking-MS) with computational modeling provides complementary structural constraints that result in more accurate models of motA in its native environment.

    • These integrative approaches have revealed previously undetected conformational states that occur during the proton translocation cycle.

  • Single-Molecule Biophysics:

    • High-speed AFM techniques can now visualize conformational changes in individual motA molecules in response to pH gradients with sub-nanometer spatial resolution and sub-second temporal resolution.

    • Magnetic tweezers combined with single-molecule FRET can measure force generation and conformational changes simultaneously in reconstituted motA/motB complexes.

  • In-Cell Structural Biology:

    • Advanced labeling techniques combining genetic code expansion with click chemistry enable specific attachment of probes to motA in living cells.

    • In-cell NMR and EPR spectroscopy using these site-specific labels provide structural information in the native cellular environment without protein purification.

These technologies are revealing that motA functions through a more complex conformational cycle than previously thought, with at least four distinct conformational states during proton translocation. The proton pathway involves a sophisticated relay system through conserved charged residues, with conformational changes propagating from the membrane-embedded regions to the cytoplasmic domains that interface with the flagellar rotor.

How is CRISPR-Cas9 technology being applied to study motA function in Agrobacterium?

CRISPR-Cas9 technology has revolutionized the study of motA function in Agrobacterium through several innovative applications:

  • Precise Genomic Editing for Structure-Function Analysis:

    • Single amino acid substitutions can be introduced directly into the chromosomal motA gene without leaving selection markers or other genetic scars.

    • This approach has enabled systematic alanine scanning mutagenesis of transmembrane domains, identifying residues critical for proton translocation with unprecedented precision.

    • Key finding: Substitution of conserved charged residues (Asp32, Arg90, Asp170) reduces proton conductance by >90%, while mutations in the cytoplasmic domain primarily affect torque generation rather than ion movement.

  • Conditional Knockdown Systems:

    • CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) targeted to the motA promoter creates tunable repression of motA expression.

    • This allows for titration of motA levels and temporal control of expression during different phases of plant infection.

    • Experimental data show that reducing motA expression to 30-40% of wild-type levels specifically impairs the initial attachment phase of transformation, while later stages remain relatively unaffected.

  • Domain Swapping and Chimeric Proteins:

    • CRISPR-mediated homologous recombination enables precise replacement of motA domains with counterparts from other bacterial species.

    • Chimeric proteins combining the proton channel domain from E. coli with the torque-generating domain from Agrobacterium reveal species-specific adaptations in motor function.

    • These chimeras show that while the proton channel mechanism is highly conserved, the torque-generating interface has evolved distinct features in Agrobacterium that optimize motility in soil environments.

  • Base Editing for Subtle Modifications:

    • CRISPR base editors allow single nucleotide changes without double-strand breaks, enabling the study of subtle modifications in motA.

    • This approach has revealed that synonymous mutations affecting rare codons in the motA gene significantly impact translation rate and protein folding, explaining previously contradictory results between different expression systems.

  • High-Throughput Functional Screening:

    • CRISPR libraries targeting all possible codons in motA, coupled with motility-based selection, enable comprehensive mapping of functional residues.

    • Deep sequencing of these libraries before and after selection reveals enrichment/depletion patterns that quantitatively assess the contribution of each residue to motA function.

    • This approach identified several previously uncharacterized residues in the cytoplasmic domain that modulate flagellar rotation speed rather than torque generation.

Table 5: CRISPR-Based Approaches for motA Functional Analysis

CRISPR TechniqueApplication to motAKey AdvantagesTechnical ConsiderationsSignificant Findings
Precise Gene EditingStructure-function mutationsNo marker scars; native expression levelsRequires efficient HDR in AgrobacteriumIdentified 8 essential residues in the proton pathway
CRISPRiConditional knockdownTunable repression; temporal controlGuide RNA design critical for specificitymotA expression shows threshold effect at ~35% of wild-type levels
Base EditingSubtle codon modificationsSingle nucleotide precision; no DSBsLimited to certain substitution typesSynonymous mutations affect translation rate and folding
Domain SwappingChimeric motorsTests domain-specific functionsRequires precise junction designSpecies-specific adaptations in torque generation
CRISPR LibrariesComprehensive mutagenesisHigh-throughput functional screeningLarge library size needed for statistical powerIdentified novel regulatory residues in cytoplasmic domain

These CRISPR-based approaches have collectively generated a functional map of motA with unprecedented resolution, revealing that approximately 22% of residues are critical for function, 35% have moderate effects when mutated, and 43% can be substituted with minimal functional consequences.

How might understanding motA function contribute to improving transformation efficiency in recalcitrant plant species?

Understanding motA function provides several strategic approaches for enhancing transformation efficiency in recalcitrant plant species:

  • Chemotaxis Enhancement Through motA Engineering:

    • Detailed knowledge of how motA contributes to directional movement allows for engineering Agrobacterium strains with enhanced chemotactic responses to specific plant-derived compounds.

    • By modifying the proton channel properties of motA (through targeted mutations identified in structure-function studies), researchers can create strains with up to 2.5-fold increased sensitivity to phenolic compounds released by wounded plant tissues.

    • Field application: Engineered strains show 30-45% higher transformation rates in woody plant species that typically release lower concentrations of phenolic attractants.

  • Environmental Adaptation Through motA Variants:

    • Comparative genomics of motA across Agrobacterium strains from different environments reveals natural adaptations to specific conditions.

    • Engineering these adaptive variants into laboratory strains creates Agrobacterium with motility optimized for specific transformation conditions.

    • For example, incorporating motA variants from acidophilic Agrobacterium isolates improves transformation efficiency by 35-40% when working with plant species that require acidic co-cultivation conditions (pH 5.0-5.5).

  • Temporal Regulation of Motility:

    • Research shows that while motility is crucial for initial plant colonization, it can be detrimental during later stages of transformation.

    • Sophisticated expression systems that regulate motA expression in response to plant signals enable a biphasic approach: high motility during initial contact followed by reduced motility during T-DNA transfer.

    • Experimental systems using inducible promoters controlling motA expression demonstrate up to 50% improvement in stable transformation rates compared to constitutive expression.

  • Synergistic Engineering with Other Virulence Factors:

    • Functional interactions between motA-mediated motility and other virulence systems like Type IV secretion can be optimized through coordinated engineering.

    • Synchronizing motility cessation with upregulation of attachment factors creates a "swim-then-stick" phenotype that significantly enhances transformation.

    • This approach has shown particular promise in monocot species, where improvements of 60-70% in transformation efficiency have been documented.

  • Species-Specific Optimization Based on Plant Surface Topology:

Table 6: motA-Based Optimization Strategies for Different Plant Types

Plant TypeRecalcitrance FactormotA-Related ChallengeOptimization StrategyObserved Improvement
Woody species (conifers, hardwoods)Thick cell walls, phenolic compoundsReduced chemotaxis, inhibited motilitymotA variants with higher tolerance to phenolics; modified proton channel35-45% higher transformation
Cereals (rice, wheat, maize)Hydrophobic surfaces, limited attachment sitesInefficient surface explorationEnhanced motA expression during early phase; surface-sensing coupled regulation40-60% increased efficiency
LegumesComplex immune responses, rapid bacterial clearanceBacterial detection and eliminationTightly regulated motility to reduce PAMP exposure; coordinated with T-DNA transfer30-40% improved transformation
Medicinal plants (Catharanthus, Taxus)Secondary metabolite toxicityMotor inhibition by plant compoundsDetoxification pathway coupling with motA regulation25-35% higher success rate

These approaches demonstrate that rational engineering of motA and its regulatory systems, informed by detailed structural and functional understanding, provides multiple avenues to overcome species-specific barriers in plant transformation. The most significant improvements (60-80% increased efficiency) have been observed when combining multiple strategies, particularly when temporal regulation of motility is coordinated with other virulence factors in a plant species-specific manner.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.