Recombinant Agrobacterium tumefaciens NADH-quinone oxidoreductase subunit K (nuoK) is a transmembrane protein component of Complex I (NADH:ubiquinone oxidoreductase), a critical enzyme in bacterial respiratory chains. It is part of the membrane domain responsible for proton translocation and electron transfer during oxidative phosphorylation .
Function: Facilitates electron transfer from NADH to ubiquinone while coupling this process to proton pumping across the membrane .
Localization: Membrane-bound subunit within the L-shaped Complex I structure, contributing to the enzyme’s proton-pumping activity .
EC Classification: EC 1.6.99.5 (NADH:ubiquinone oxidoreductase) .
The recombinant nuoK protein spans 1–102 amino acids (AA), with a His-tag for purification. The sequence includes hydrophobic regions critical for membrane integration :
| Sequence Segment | Amino Acid Residues | Key Features |
|---|---|---|
| N-terminal | MVIGLSHYLTVSAILFTIGVFGIFLNRKNVIVILMSIELILLAVNINMVAFSAFLNDIVG | Hydrophobic motifs for membrane anchoring |
| Central | QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG | Predicted transmembrane helices |
nuoK interacts with other membrane subunits (e.g., NuoA, NuoL) to form the proton-translocating machinery. Mutagenesis studies in analogous subunits (e.g., NuoM in E. coli) highlight conserved residues (e.g., Glu 144, Lys 234) critical for proton pumping .
Proton Translocation: In E. coli, analogous subunits (e.g., NuoM) require conserved acidic residues (e.g., Glu 144) for proton pumping .
Cation Transport: A. tumefaciens Mrp antiporters indirectly influence proton gradients, suggesting nuanced roles for nuoK in ion homeostasis .
| Enzyme | Subunit | Function | Key Distinction |
|---|---|---|---|
| Complex I (nuoK) | Transmembrane | Proton-pumping NADH dehydrogenase | Multisubunit, H+/Na+ coupling |
| NDH-2 (Type II) | Soluble | Non-pumping NADH dehydrogenase | Single subunit, no proton transport |
KEGG: atu:Atu1280
STRING: 176299.Atu1280
Agrobacterium tumefaciens is a rod-shaped, Gram-negative soil bacterium known for causing crown gall disease in over 140 species of eudicots. Its significance in scientific research stems from its unique natural ability to transfer DNA into plant genomes. Crown gall disease is characterized by the formation of large tumors or galls, typically found at the bases of stems, which can severely hinder a plant's ability to absorb water and nutrients .
A. tumefaciens has become an invaluable tool in plant biotechnology due to this DNA transfer capability. Scientists have harnessed this mechanism to introduce beneficial traits into plants, making it the single most important tool in agricultural biotechnology. Economically, A. tumefaciens affects a wide variety of plants including walnuts, grape vines, stone fruits, nut trees, and sugar beets .
Complex I is predicted to be widespread in bacteria, present in approximately 52% of analyzed bacterial genomes (based on a study of 1,058 representative genomes including 970 bacterial and 88 archaeal genomes) . The genes encoding Complex I (nuoA to nuoN) are colocalized in 86% of bacterial genomes where the enzyme was found, indicating they may form a polycistronic operon similar to that in Escherichia coli .
Based on available research data, recombinant A. tumefaciens nuoK protein can be successfully expressed in E. coli expression systems . The following protocol has been implemented for production of high-quality protein:
Expression System: E. coli bacterial expression system
Protein Construct: Full-length nuoK (1-102 amino acids) with an N-terminal His-tag
Purification Method: Affinity chromatography utilizing the His-tag
Storage Solution: Tris/PBS-based buffer with 6% Trehalose, pH 8.0
Storage Recommendations: Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use
For reconstitution of the lyophilized protein:
Briefly centrifuge the vial prior to opening to bring contents to the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C
It's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.
Several complementary methodological approaches have been developed to study ion transport by Complex I and its subunits:
Fluorescence Spectroscopy: This technique can be used to monitor H+ transport during NADH:quinone oxidoreductase activity of Complex I. Fluorescent probes sensitive to changes in pH can detect proton movements across membranes .
23Na-NMR Spectroscopy: This has been successfully employed to monitor Na+ transport by Complex I. The technique allows for real-time observation of Na+ movements in the presence and absence of specific inhibitors .
Inhibitor Studies: Compounds like EIPA (5-N-ethyl-N-isopropyl-amiloride) can be used at different concentrations to study the coupling between catalytic and transport activities of Complex I .
Mutational Analysis: Creating subunit-deletion mutants (such as those lacking NuoL) allows researchers to study the specific contributions of individual subunits to ion transport. This approach revealed that the NuoL subunit is involved in Na+/H+ antiporting activity .
Reconstitution into Liposomes: Purified Complex I or individual subunits can be incorporated into artificial membrane systems to study their transport properties in isolation from other cellular components .
These methods can be applied to study nuoK's role by creating specific mutations or deletions in the nuoK gene and observing the effects on ion transport capabilities of the complex.
The relationship between NADH-quinone oxidoreductase (Complex I) and A. tumefaciens pathogenicity is multifaceted:
Energy Production During Infection: Complex I is a key component of the respiratory chain, providing energy needed during the infection process. Efficient energy metabolism is crucial for bacterial survival during the early stages of plant colonization .
Growth Under Varying Oxygen Conditions: A. tumefaciens can grow anaerobically via denitrification, and the respiratory chain including Complex I may play a role in adapting to the varying oxygen conditions encountered during the infection process .
Response to Plant Defense Mechanisms: Plant defense responses often include oxidative bursts. The bacterial respiratory chain, including Complex I, may contribute to stress resistance mechanisms that help A. tumefaciens overcome plant defenses .
Adaptation to Plant Environment: The ability of Complex I to pump protons and potentially participate in Na+/H+ antiporting (as suggested by studies on related systems) might help A. tumefaciens adapt to the ionic environment of plant tissues .
Research has shown that when A. tumefaciens is infiltrated into plant leaves, there are changes in the expression of genes related to respiration, including those involved in nitrogen oxide respiration . This suggests that respiratory chain components, including Complex I, may be regulated in response to plant signals.
The structure-function relationship of nuoK reveals several important insights:
Contribution to the Proton Translocation Pathway: Based on studies of Complex I from different organisms, the membrane subunits, including nuoK, form part of the proton translocation machinery. The arrangement of these subunits creates a pathway for proton movement across the membrane .
Role in Energy Coupling: NuoK likely participates in the conformational changes that couple electron transfer in the hydrophilic arm of Complex I to proton translocation through the membrane domain. This coupling mechanism appears to involve both direct proton pumping and Na+/H+ antiporting activities .
Interaction with Other Subunits: Research using techniques like yeast two-hybrid studies suggests that membrane subunits interact extensively with each other. NuoK may interact with other membrane subunits to form a functional proton translocation module .
While the specific details of nuoK's contribution to ion translocation remain under investigation, its conservation across bacterial Complex I suggests it plays an essential role in the energy transduction mechanism.
Environmental factors significantly influence nuoK expression and function in A. tumefaciens:
Oxygen Availability: A. tumefaciens can grow both aerobically and anaerobically (via denitrification). The expression of respiratory chain components, including Complex I subunits like nuoK, is likely regulated in response to oxygen levels. Under low oxygen conditions, such as those potentially encountered in plant tissues, alternative respiratory pathways may be upregulated .
Temperature Effects: A. tumefaciens grows optimally at 28°C. At temperatures above 30°C, it experiences heat shock, which can result in errors in cell division and potentially affect the expression and assembly of membrane proteins like nuoK . This temperature sensitivity may affect nuoK function during seasonal temperature variations in soil and plant environments.
Plant-Derived Signals: When A. tumefaciens interacts with plants, it responds to plant-derived signals like phenolic compounds. These signals activate virulence (vir) genes through the VirA/VirG two-component sensor system . While not directly controlling nuoK, this signaling network may indirectly influence metabolic adaptations, including respiratory chain components.
Ionic Environment: The function of Complex I, including nuoK, involves ion translocation. Changes in the ionic environment (such as pH or salt concentrations) encountered during plant infection may affect the efficiency of this process. Research has shown that mutations affecting membrane components can alter A. tumefaciens virulence, suggesting a link between membrane function and pathogenicity .
Regulatory Controls: Two transcription factors, ActR and FnrN, have been identified as controlling the expression of genes involved in anaerobic respiration in A. tumefaciens . While direct regulation of nuoK by these factors hasn't been specifically demonstrated, they represent potential mechanisms for environmental regulation of respiratory chain components.
Studies on nuoK and Complex I in A. tumefaciens provide valuable insights into respiratory chain evolution:
A comprehensive phylogenomic analysis of 14-subunit Complex I distribution across bacterial genomes revealed it is present in about 52% of analyzed bacterial genomes, highlighting its widespread but not universal nature . This pattern suggests multiple loss and gain events throughout bacterial evolution, reflecting diverse adaptations to different energy requirements and environmental conditions.
Studying membrane proteins like nuoK presents several methodological challenges:
Expression and Purification:
Challenge: Membrane proteins are notoriously difficult to express and purify in functional form due to their hydrophobicity and requirement for a lipid environment.
Novel Approaches:
Structural Determination:
Challenge: Traditional structural biology techniques are challenging to apply to membrane proteins.
Novel Approaches:
Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology
Advanced NMR techniques for membrane proteins
X-ray crystallography with specialized detergents and crystallization methods
Functional Assays:
Integration Within Complex I:
In vivo Studies:
Challenge: Studying membrane protein function in living cells without disrupting normal physiology.
Novel Approaches:
Development of minimally invasive probes
Optogenetic approaches to control protein activity
Advanced imaging techniques to visualize protein localization and dynamics
The field continues to develop innovative approaches to overcome these challenges, including synthetic biology strategies that are being explored for A. tumefaciens to enable more precise genetic control and functional analysis of components like nuoK .
Understanding nuoK and Complex I function could lead to several innovative strategies:
Novel Target for Crown Gall Disease Control:
If nuoK proves essential for A. tumefaciens survival or virulence, it could become a target for developing specific inhibitors that disrupt bacterial energy metabolism without harming plants.
Research has shown that membrane composition affects A. tumefaciens virulence; targeting components like nuoK that are part of membrane complexes could provide new avenues for disease control .
Improved Plant Transformation Efficiency:
Engineering A. tumefaciens for Enhanced Capabilities:
Synthetic biology approaches could modify respiratory chain components to create strains with enhanced survival under specific conditions or with optimized energy production for improved transformation efficiency .
The table below summarizes potential engineering targets related to energy metabolism in A. tumefaciens:
| Target | Current Function | Potential Modification | Expected Outcome |
|---|---|---|---|
| nuoK | Component of Complex I, involved in energy conservation | Overexpression | Enhanced energy production, potentially increasing virulence or survival |
| Complex I | Energy conservation through proton pumping | Optimization for specific conditions | Improved bacterial survival during plant transformation |
| Membrane composition | Affects protein function and cellular processes | Modification to alter membrane properties | Enhanced virulence or transformation efficiency |
| Respiratory chain regulation | Adaptation to oxygen availability | Engineering for improved low-oxygen tolerance | Better performance in plant tissues with variable oxygen levels |
Bioenergetic Insights for Strain Development:
Understanding how A. tumefaciens manages its energy budget during infection could inform the development of strains with enhanced transformation efficiency under specific conditions.
Research has shown that many external factors influence transformation efficiency; knowledge of how energy metabolism responds to these factors could guide optimization efforts .
Cross-species Applications:
By applying a rigorous synthetic biology approach to tailor strains of A. tumefaciens used in plant transformation, researchers could potentially overcome current limitations in transformation efficiency and host range .
Several promising research directions emerge from the current understanding of nuoK:
Structure-Function Analysis:
Role in Environmental Adaptation:
Integration with Pathogenicity Mechanisms:
Synthetic Biology Applications:
Comparative Studies Across Species:
These research directions would contribute to a more comprehensive understanding of nuoK's role in A. tumefaciens biology and could lead to applications in biotechnology and agriculture.
Emerging technologies offer exciting possibilities for advancing nuoK research:
Cryo-Electron Microscopy (Cryo-EM):
Allows visualization of membrane proteins without crystallization
Can resolve structures at near-atomic resolution
Enables visualization of different conformational states of Complex I, potentially revealing how nuoK participates in energy transduction
AlphaFold and Other AI-Based Structure Prediction:
Provides accurate structural models even for challenging membrane proteins
Can predict protein-protein interactions, potentially elucidating how nuoK interfaces with other Complex I subunits
Enables rapid hypothesis generation for structure-function relationships
Single-Molecule Techniques:
Allow observation of individual protein molecules in action
Can detect conformational changes and rare events not visible in bulk measurements
May reveal dynamic aspects of nuoK function within Complex I
CRISPR-Cas Systems for A. tumefaciens:
Synthetic Biology Parts for A. tumefaciens:
Advanced Biophysical Techniques:
Systems Biology Approaches:
Integration of proteomics, transcriptomics, and metabolomics data
Network analysis to understand how nuoK functions within the broader cellular context
Computational modeling of energy metabolism including Complex I function
The application of these technologies to nuoK research could dramatically accelerate progress in understanding its structure, function, and role in A. tumefaciens biology, potentially leading to new applications in biotechnology and agriculture .