Recombinant Agrobacterium tumefaciens NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Agrobacterium tumefaciens NADH-quinone oxidoreductase subunit K (nuoK) is a transmembrane protein component of Complex I (NADH:ubiquinone oxidoreductase), a critical enzyme in bacterial respiratory chains. It is part of the membrane domain responsible for proton translocation and electron transfer during oxidative phosphorylation .

Key Features

  • Function: Facilitates electron transfer from NADH to ubiquinone while coupling this process to proton pumping across the membrane .

  • Localization: Membrane-bound subunit within the L-shaped Complex I structure, contributing to the enzyme’s proton-pumping activity .

  • EC Classification: EC 1.6.99.5 (NADH:ubiquinone oxidoreductase) .

Amino Acid Sequence

The recombinant nuoK protein spans 1–102 amino acids (AA), with a His-tag for purification. The sequence includes hydrophobic regions critical for membrane integration :

Sequence SegmentAmino Acid ResiduesKey Features
N-terminalMVIGLSHYLTVSAILFTIGVFGIFLNRKNVIVILMSIELILLAVNINMVAFSAFLNDIVGHydrophobic motifs for membrane anchoring
CentralQVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKGPredicted transmembrane helices

Membrane Domain Interactions

nuoK interacts with other membrane subunits (e.g., NuoA, NuoL) to form the proton-translocating machinery. Mutagenesis studies in analogous subunits (e.g., NuoM in E. coli) highlight conserved residues (e.g., Glu 144, Lys 234) critical for proton pumping .

Functional Insights from Related Organisms

  • Proton Translocation: In E. coli, analogous subunits (e.g., NuoM) require conserved acidic residues (e.g., Glu 144) for proton pumping .

  • Cation Transport: A. tumefaciens Mrp antiporters indirectly influence proton gradients, suggesting nuanced roles for nuoK in ion homeostasis .

Comparative Analysis with Other NADH Dehydrogenases

EnzymeSubunitFunctionKey Distinction
Complex I (nuoK)TransmembraneProton-pumping NADH dehydrogenaseMultisubunit, H+/Na+ coupling
NDH-2 (Type II)SolubleNon-pumping NADH dehydrogenaseSingle subunit, no proton transport

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography of recombinant nuoK is needed to map its interactions within Complex I .

  • Functional Redundancy: A. tumefaciens lacks Complex I in some strains, raising questions about alternative electron transfer pathways .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nuoK; Atu1280; AGR_C_2359; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
nuoK
Target Protein Sequence
MVIGLSHYLTVSAILFTIGVFGIFLNRKNVIVILMSIELILLAVNINMVAFSAFLNDIVG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links

KEGG: atu:Atu1280

STRING: 176299.Atu1280

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium tumefaciens and why is it significant in scientific research?

Agrobacterium tumefaciens is a rod-shaped, Gram-negative soil bacterium known for causing crown gall disease in over 140 species of eudicots. Its significance in scientific research stems from its unique natural ability to transfer DNA into plant genomes. Crown gall disease is characterized by the formation of large tumors or galls, typically found at the bases of stems, which can severely hinder a plant's ability to absorb water and nutrients .

A. tumefaciens has become an invaluable tool in plant biotechnology due to this DNA transfer capability. Scientists have harnessed this mechanism to introduce beneficial traits into plants, making it the single most important tool in agricultural biotechnology. Economically, A. tumefaciens affects a wide variety of plants including walnuts, grape vines, stone fruits, nut trees, and sugar beets .

How is Complex I predicted to be distributed across bacterial species, and is it present in Agrobacterium tumefaciens?

Complex I is predicted to be widespread in bacteria, present in approximately 52% of analyzed bacterial genomes (based on a study of 1,058 representative genomes including 970 bacterial and 88 archaeal genomes) . The genes encoding Complex I (nuoA to nuoN) are colocalized in 86% of bacterial genomes where the enzyme was found, indicating they may form a polycistronic operon similar to that in Escherichia coli .

What are the recommended expression systems and purification protocols for recombinant Agrobacterium tumefaciens nuoK?

Based on available research data, recombinant A. tumefaciens nuoK protein can be successfully expressed in E. coli expression systems . The following protocol has been implemented for production of high-quality protein:

  • Expression System: E. coli bacterial expression system

  • Protein Construct: Full-length nuoK (1-102 amino acids) with an N-terminal His-tag

  • Purification Method: Affinity chromatography utilizing the His-tag

  • Storage Solution: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Storage Recommendations: Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use

For reconstitution of the lyophilized protein:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

It's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.

What methodologies are available for studying the ion transport function of nuoK within Complex I?

Several complementary methodological approaches have been developed to study ion transport by Complex I and its subunits:

  • Fluorescence Spectroscopy: This technique can be used to monitor H+ transport during NADH:quinone oxidoreductase activity of Complex I. Fluorescent probes sensitive to changes in pH can detect proton movements across membranes .

  • 23Na-NMR Spectroscopy: This has been successfully employed to monitor Na+ transport by Complex I. The technique allows for real-time observation of Na+ movements in the presence and absence of specific inhibitors .

  • Inhibitor Studies: Compounds like EIPA (5-N-ethyl-N-isopropyl-amiloride) can be used at different concentrations to study the coupling between catalytic and transport activities of Complex I .

  • Mutational Analysis: Creating subunit-deletion mutants (such as those lacking NuoL) allows researchers to study the specific contributions of individual subunits to ion transport. This approach revealed that the NuoL subunit is involved in Na+/H+ antiporting activity .

  • Reconstitution into Liposomes: Purified Complex I or individual subunits can be incorporated into artificial membrane systems to study their transport properties in isolation from other cellular components .

These methods can be applied to study nuoK's role by creating specific mutations or deletions in the nuoK gene and observing the effects on ion transport capabilities of the complex.

How does the function of NADH-quinone oxidoreductase in A. tumefaciens relate to its pathogenicity and interaction with plant hosts?

The relationship between NADH-quinone oxidoreductase (Complex I) and A. tumefaciens pathogenicity is multifaceted:

  • Energy Production During Infection: Complex I is a key component of the respiratory chain, providing energy needed during the infection process. Efficient energy metabolism is crucial for bacterial survival during the early stages of plant colonization .

  • Growth Under Varying Oxygen Conditions: A. tumefaciens can grow anaerobically via denitrification, and the respiratory chain including Complex I may play a role in adapting to the varying oxygen conditions encountered during the infection process .

  • Response to Plant Defense Mechanisms: Plant defense responses often include oxidative bursts. The bacterial respiratory chain, including Complex I, may contribute to stress resistance mechanisms that help A. tumefaciens overcome plant defenses .

  • Adaptation to Plant Environment: The ability of Complex I to pump protons and potentially participate in Na+/H+ antiporting (as suggested by studies on related systems) might help A. tumefaciens adapt to the ionic environment of plant tissues .

Research has shown that when A. tumefaciens is infiltrated into plant leaves, there are changes in the expression of genes related to respiration, including those involved in nitrogen oxide respiration . This suggests that respiratory chain components, including Complex I, may be regulated in response to plant signals.

What is known about the structure-function relationship of nuoK and how does it contribute to ion translocation by Complex I?

The structure-function relationship of nuoK reveals several important insights:

  • Contribution to the Proton Translocation Pathway: Based on studies of Complex I from different organisms, the membrane subunits, including nuoK, form part of the proton translocation machinery. The arrangement of these subunits creates a pathway for proton movement across the membrane .

  • Role in Energy Coupling: NuoK likely participates in the conformational changes that couple electron transfer in the hydrophilic arm of Complex I to proton translocation through the membrane domain. This coupling mechanism appears to involve both direct proton pumping and Na+/H+ antiporting activities .

  • Interaction with Other Subunits: Research using techniques like yeast two-hybrid studies suggests that membrane subunits interact extensively with each other. NuoK may interact with other membrane subunits to form a functional proton translocation module .

While the specific details of nuoK's contribution to ion translocation remain under investigation, its conservation across bacterial Complex I suggests it plays an essential role in the energy transduction mechanism.

How do environmental factors affect the expression and function of nuoK in A. tumefaciens, particularly during plant infection?

Environmental factors significantly influence nuoK expression and function in A. tumefaciens:

  • Oxygen Availability: A. tumefaciens can grow both aerobically and anaerobically (via denitrification). The expression of respiratory chain components, including Complex I subunits like nuoK, is likely regulated in response to oxygen levels. Under low oxygen conditions, such as those potentially encountered in plant tissues, alternative respiratory pathways may be upregulated .

  • Temperature Effects: A. tumefaciens grows optimally at 28°C. At temperatures above 30°C, it experiences heat shock, which can result in errors in cell division and potentially affect the expression and assembly of membrane proteins like nuoK . This temperature sensitivity may affect nuoK function during seasonal temperature variations in soil and plant environments.

  • Plant-Derived Signals: When A. tumefaciens interacts with plants, it responds to plant-derived signals like phenolic compounds. These signals activate virulence (vir) genes through the VirA/VirG two-component sensor system . While not directly controlling nuoK, this signaling network may indirectly influence metabolic adaptations, including respiratory chain components.

  • Ionic Environment: The function of Complex I, including nuoK, involves ion translocation. Changes in the ionic environment (such as pH or salt concentrations) encountered during plant infection may affect the efficiency of this process. Research has shown that mutations affecting membrane components can alter A. tumefaciens virulence, suggesting a link between membrane function and pathogenicity .

  • Regulatory Controls: Two transcription factors, ActR and FnrN, have been identified as controlling the expression of genes involved in anaerobic respiration in A. tumefaciens . While direct regulation of nuoK by these factors hasn't been specifically demonstrated, they represent potential mechanisms for environmental regulation of respiratory chain components.

How can studies on nuoK and Complex I contribute to understanding the evolution of respiratory chains in alpha-proteobacteria?

Studies on nuoK and Complex I in A. tumefaciens provide valuable insights into respiratory chain evolution:

A comprehensive phylogenomic analysis of 14-subunit Complex I distribution across bacterial genomes revealed it is present in about 52% of analyzed bacterial genomes, highlighting its widespread but not universal nature . This pattern suggests multiple loss and gain events throughout bacterial evolution, reflecting diverse adaptations to different energy requirements and environmental conditions.

What are the methodological challenges in studying membrane proteins like nuoK, and what novel approaches are being developed to address these challenges?

Studying membrane proteins like nuoK presents several methodological challenges:

  • Expression and Purification:

    • Challenge: Membrane proteins are notoriously difficult to express and purify in functional form due to their hydrophobicity and requirement for a lipid environment.

    • Novel Approaches:

      • Specialized expression systems with membrane protein tags

      • Cell-free expression systems that incorporate artificial membranes

      • Fusion with soluble partners to improve expression yields

  • Structural Determination:

    • Challenge: Traditional structural biology techniques are challenging to apply to membrane proteins.

    • Novel Approaches:

      • Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology

      • Advanced NMR techniques for membrane proteins

      • X-ray crystallography with specialized detergents and crystallization methods

  • Functional Assays:

    • Challenge: Measuring the activity of individual subunits within a complex is difficult.

    • Novel Approaches:

      • Reconstitution into nanodiscs or liposomes

      • Development of specific fluorescent probes for ion movement

      • Single-molecule techniques to observe conformational changes

  • Integration Within Complex I:

    • Challenge: Understanding how nuoK functions within the larger Complex I structure.

    • Novel Approaches:

      • Site-directed mutagenesis combined with activity assays

      • Cross-linking studies to identify interacting partners

      • Computational modeling of energy transfer pathways

  • In vivo Studies:

    • Challenge: Studying membrane protein function in living cells without disrupting normal physiology.

    • Novel Approaches:

      • Development of minimally invasive probes

      • Optogenetic approaches to control protein activity

      • Advanced imaging techniques to visualize protein localization and dynamics

The field continues to develop innovative approaches to overcome these challenges, including synthetic biology strategies that are being explored for A. tumefaciens to enable more precise genetic control and functional analysis of components like nuoK .

How might understanding nuoK and Complex I function contribute to developing new strategies for controlling crown gall disease or improving plant transformation technologies?

Understanding nuoK and Complex I function could lead to several innovative strategies:

  • Novel Target for Crown Gall Disease Control:

    • If nuoK proves essential for A. tumefaciens survival or virulence, it could become a target for developing specific inhibitors that disrupt bacterial energy metabolism without harming plants.

    • Research has shown that membrane composition affects A. tumefaciens virulence; targeting components like nuoK that are part of membrane complexes could provide new avenues for disease control .

  • Improved Plant Transformation Efficiency:

    • A deeper understanding of A. tumefaciens metabolism could lead to optimized growth conditions that enhance transformation efficiency.

    • Modifying expression of metabolic genes, potentially including those involved in energy production like nuoK, could lead to more efficient T-DNA transfer .

  • Engineering A. tumefaciens for Enhanced Capabilities:

    • Synthetic biology approaches could modify respiratory chain components to create strains with enhanced survival under specific conditions or with optimized energy production for improved transformation efficiency .

    • The table below summarizes potential engineering targets related to energy metabolism in A. tumefaciens:

TargetCurrent FunctionPotential ModificationExpected Outcome
nuoKComponent of Complex I, involved in energy conservationOverexpressionEnhanced energy production, potentially increasing virulence or survival
Complex IEnergy conservation through proton pumpingOptimization for specific conditionsImproved bacterial survival during plant transformation
Membrane compositionAffects protein function and cellular processesModification to alter membrane propertiesEnhanced virulence or transformation efficiency
Respiratory chain regulationAdaptation to oxygen availabilityEngineering for improved low-oxygen toleranceBetter performance in plant tissues with variable oxygen levels
  • Bioenergetic Insights for Strain Development:

    • Understanding how A. tumefaciens manages its energy budget during infection could inform the development of strains with enhanced transformation efficiency under specific conditions.

    • Research has shown that many external factors influence transformation efficiency; knowledge of how energy metabolism responds to these factors could guide optimization efforts .

  • Cross-species Applications:

    • Insights from A. tumefaciens Complex I could potentially be applied to related species used in agricultural biotechnology, expanding the toolbox of organisms available for plant transformation .

By applying a rigorous synthetic biology approach to tailor strains of A. tumefaciens used in plant transformation, researchers could potentially overcome current limitations in transformation efficiency and host range .

What are the most promising avenues for future research on nuoK and its role in A. tumefaciens biology?

Several promising research directions emerge from the current understanding of nuoK:

  • Structure-Function Analysis:

    • Detailed structural studies of nuoK within the context of the complete Complex I

    • Site-directed mutagenesis of conserved residues to determine their specific roles

    • Investigation of protein-protein interactions between nuoK and other Complex I subunits

  • Role in Environmental Adaptation:

    • Study of nuoK expression and function under various environmental conditions relevant to plant-microbe interactions

    • Investigation of how nuoK contributes to adaptation to different plant hosts

    • Analysis of nuoK variants across A. tumefaciens strains with different host ranges or virulence profiles

  • Integration with Pathogenicity Mechanisms:

    • Investigation of potential links between energy metabolism (involving nuoK) and virulence mechanisms

    • Analysis of metabolic adaptations during different stages of plant infection

    • Exploration of how nuoK-containing complexes respond to plant defense responses

  • Synthetic Biology Applications:

    • Development of engineered A. tumefaciens strains with modified nuoK or Complex I properties

    • Creation of biosensors based on nuoK function to monitor cellular energy status

    • Design of minimal respiratory systems to understand the essential functions of nuoK

  • Comparative Studies Across Species:

    • Analysis of nuoK function in related Rhizobiaceae with different plant interaction strategies (pathogens vs. symbionts)

    • Investigation of how nuoK has evolved across different bacterial lineages

    • Identification of unique features of A. tumefaciens nuoK compared to homologs in other bacteria

These research directions would contribute to a more comprehensive understanding of nuoK's role in A. tumefaciens biology and could lead to applications in biotechnology and agriculture.

How might emerging technologies in structural biology and synthetic biology accelerate research on nuoK and Complex I?

Emerging technologies offer exciting possibilities for advancing nuoK research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of membrane proteins without crystallization

    • Can resolve structures at near-atomic resolution

    • Enables visualization of different conformational states of Complex I, potentially revealing how nuoK participates in energy transduction

  • AlphaFold and Other AI-Based Structure Prediction:

    • Provides accurate structural models even for challenging membrane proteins

    • Can predict protein-protein interactions, potentially elucidating how nuoK interfaces with other Complex I subunits

    • Enables rapid hypothesis generation for structure-function relationships

  • Single-Molecule Techniques:

    • Allow observation of individual protein molecules in action

    • Can detect conformational changes and rare events not visible in bulk measurements

    • May reveal dynamic aspects of nuoK function within Complex I

  • CRISPR-Cas Systems for A. tumefaciens:

    • Enable precise genome editing to create specific mutations in nuoK

    • Allow for rapid generation of multiple variant strains

    • Facilitate the creation of conditional knockdowns to study essential functions

  • Synthetic Biology Parts for A. tumefaciens:

    • Development of well-characterized promoters, RBS sequences, and other genetic parts

    • Enable precise control of nuoK expression levels

    • Allow for the creation of synthetic circuits to study nuoK regulation

  • Advanced Biophysical Techniques:

    • Techniques like solid-state NMR specifically designed for membrane proteins

    • Advanced fluorescence approaches to monitor conformational changes

    • New methods to measure ion translocation with high temporal resolution

  • Systems Biology Approaches:

    • Integration of proteomics, transcriptomics, and metabolomics data

    • Network analysis to understand how nuoK functions within the broader cellular context

    • Computational modeling of energy metabolism including Complex I function

The application of these technologies to nuoK research could dramatically accelerate progress in understanding its structure, function, and role in A. tumefaciens biology, potentially leading to new applications in biotechnology and agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.