Recombinant Agrobacterium tumefaciens Nopaline transport system permease protein nocM (nocM)

Shipped with Ice Packs
In Stock

Description

Introduction to NocM

Recombinant Agrobacterium tumefaciens Nopaline transport system permease protein NocM (nocM) is a bacterial membrane protein critical for the uptake of nopaline, an opine metabolite produced by crown gall tumors in infected plants. This protein is encoded by the nocM gene located on the Tumor-inducing (Ti) plasmid, which enables A. tumefaciens to metabolize nopaline as a nutrient source during pathogenesis . Recombinant NocM is engineered for research applications, enabling studies on bacterial-plant interactions, opine transport mechanisms, and bioremediation tools .

Biological Role and Mechanism

NocM functions as a permease in the nopaline transport system, facilitating the import of nopaline into A. tumefaciens. This process is tightly linked to the bacterium’s pathogenicity and ecological adaptation:

  • Opine Utilization: Nopaline acts as a chemoattractant and nutrient, promoting bacterial growth in the rhizosphere. The nocM-mediated transport system allows A. tumefaciens to exploit plant tumors as opine production sites .

  • Quorum Sensing Regulation: Nopaline activates the TraR transcriptional regulator, initiating Ti plasmid conjugation between agrobacteria. This horizontal gene transfer enhances virulence and opine metabolism in bacterial populations .

  • Pathogenicity Cycle: NocM is part of a feedback loop where opines from infected plants sustain A. tumefaciens populations, ensuring continued T-DNA transfer and tumorigenesis .

4.1. Mechanistic Studies of Opine Transport

Recombinant NocM enables in vitro analysis of nopaline uptake kinetics and structural modeling. For example, homology modeling using tools like RoseTTaFold predicts a transmembrane β-barrel structure typical of permeases, with conserved domains for substrate binding and membrane integration .

4.2. Biotechnological Engineering

NocM has been leveraged in synthetic biology to engineer A. tumefaciens strains with enhanced adhesion or targeted protein display capabilities. For instance:

  • Fusion proteins incorporating NocM’s transmembrane domains have been used to display heterologous peptides on bacterial surfaces for plant cell targeting .

  • Modifications to the nopaline transport system could optimize opine-based selection in genetically engineered crops .

4.3. Pathogenesis and Host Interaction

Studies using NocM-deficient strains reveal impaired nopaline uptake, reducing bacterial fitness in plant tumors. This highlights NocM’s role in sustaining A. tumefaciens during infection .

Future Directions

Research gaps include elucidating NocM’s interaction partners in the nopaline transport complex and its regulatory crosstalk with other virulence factors (e.g., VirB/VirD4). Additionally, engineering NocM for high-efficiency opine uptake could enhance Agrobacterium-mediated plant transformation systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing it accordingly.
Synonyms
nocM; Atu6025; AGR_pTi_65; Nopaline transport system permease protein NocM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
nocM
Target Protein Sequence
MDIQLIIESFPKLLAAVPTTLTLAFISLLIGFVVSVPVALMRLSKNRIVSSLAYGYVYII RSTPLLVQMFLIYYGSAQFRGVLSEVGLWSSFREPWFCAILALALNTAAYTSEIIRGGIQ SVSLGQIEAARAVGMSTFLQFRRIVFPIAIRQALPAYGNEVMLIIKSTSLASTITIVEVT GLAKQIISATYSPVEVFIVAGAIYLFITFVVSRLVMLAEWWLNPHMRARVGGTAPKAAET H
Uniprot No.

Target Background

Function
The NocM protein is a component of the nopaline active transport system in Agrobacterium tumefaciens. This system likely comprises four subunits: Q, M, P, and T. It is also capable of transporting octopine when catabolic functions are induced by nopaline.
Database Links

KEGG: atu:Atu6025

Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the nocM protein and its role in Agrobacterium tumefaciens?

The nocM protein is a critical component of the nopaline catabolism (noc) system in Agrobacterium tumefaciens. It functions as a permease protein within the nopaline transport system, facilitating the uptake of nopaline into the bacterial cell. The noc operon, which includes nocM, codes for the transport and catabolism of, as well as chemotaxis to, nopaline opines . This transport system is analogous to the acc operon that facilitates agrocinopine uptake, where genes like accABCDE code for an ABC-type transport system .

The nocM permease represents a specialized adaptation that enables A. tumefaciens to utilize plant-produced opines as exclusive nutrient sources. This creates a privileged nutritional niche for the bacterium in the plant tumor environment, contributing significantly to its ecological success as a pathogen.

What are opines and why are they important in Agrobacterium research?

Opines are low-molecular-weight carbon compounds that belong to a large group of plant tumor-specific metabolites produced by plants transformed with Agrobacterium tumefaciens. Crown gall tumors induced by the nopaline-type A. tumefaciens strain C58 synthesize and secrete two families of tumor metabolites: agrocinopines A and B, and nopaline . These compounds result from the expression of bacterial genes that become integrated into the plant chromosome during infection.

The genes responsible for opine biosynthesis are carried on the T region of the Ti plasmid, which is transferred from the bacterium to the plant where it becomes integrated into the host chromosome . This genetic colonization represents a sophisticated parasitic strategy where the bacterium engineers its host to produce compounds that primarily benefit the infecting organism.

Opines are scientifically significant because they represent a unique nutritional adaptation where Agrobacterium creates and exploits a specialized ecological niche. By studying opine catabolism systems like nocM, researchers gain insights into the evolution of host-pathogen relationships and specialized metabolic pathways.

How does the noc operon relate to other opine utilization systems in Agrobacterium?

The noc operon in Agrobacterium tumefaciens strain C58 is specifically responsible for nopaline catabolism, while a separate operon, acc, controls agrocinopine catabolism . Both operons are located on the non-transferred region of the Ti plasmid and encode functions for transport, catabolism, and chemotaxis to their respective opines .

While the acc operon consists of eight genes (accR and accABCDEFG), with accR coding for a repressor that regulates this locus and controls conjugative transfer of pTiC58 in response to agrocinopines A and B , the noc operon has a similar organizational structure optimized for nopaline utilization. This parallel organization reflects the evolutionary adaptation of Agrobacterium to efficiently exploit different opine types.

The comparison below highlights key similarities and differences between these systems:

Featurenoc operon (Nopaline system)acc operon (Agrocinopine system)
SubstrateNopalineAgrocinopines A and B
LocationNon-transferred region of Ti plasmidNon-transferred region of Ti plasmid
FunctionsTransport, catabolism, chemotaxisTransport, catabolism, chemotaxis
Transport systemIncludes nocM permeaseABC-type (accABCDE)
RegulationLikely substrate-inducedRepressed by accR, induced by agrocinopines and phosphate limitation

This organizational similarity suggests a common evolutionary origin for these specialized metabolic systems, while their substrate specificity reflects adaptation to different opine classes.

What methodological approaches are recommended for studying nocM function?

When investigating nocM function, researchers should employ multiple complementary approaches to build a comprehensive understanding of this permease protein. Recommended methodologies include:

  • Genetic manipulation studies:

    • Gene knockout experiments to create nocM deletion mutants

    • Complementation assays to confirm phenotype restoration

    • Site-directed mutagenesis to identify critical functional residues

  • Transport assays:

    • Radioactive-labeled nopaline uptake experiments

    • Competition assays with structural analogs

    • Kinetic analysis of transport parameters (Km, Vmax)

  • Protein characterization:

    • Expression and purification of recombinant nocM

    • Structural analysis using crystallography or cryo-EM

    • Protein-protein interaction studies with other noc operon products

How should researchers address contradictory results in nocM functional studies?

Addressing contradictory results in nocM functional studies requires a systematic approach that considers multiple factors:

The existence of contradictory results should not be viewed negatively but rather as an opportunity to develop more sophisticated models of nocM function that account for context-dependent behavior.

What considerations are important for expressing recombinant nocM protein?

Expressing functional recombinant nocM protein presents several challenges due to its nature as a membrane-integrated permease. Key considerations include:

  • Expression system selection:

    • E. coli systems (BL21, C41/C43) optimized for membrane proteins

    • Alternative hosts (Lactococcus lactis, Pichia pastoris) for problematic proteins

    • Cell-free systems for toxic membrane proteins

  • Vector design:

    • Fusion tags (His6, MBP, GST) to improve solubility and detection

    • Inducible promoters with tunable expression levels

    • Signal sequences appropriate for membrane targeting

  • Optimization parameters:

    • Temperature (often lowered to 16-25°C for membrane proteins)

    • Inducer concentration (typically reduced for membrane proteins)

    • Media formulation (supplemented with glycerol, specific ions)

    • Expression duration (extended for proper membrane integration)

  • Solubilization strategy:

    • Detergent screening (DDM, LDAO, Fos-Choline series)

    • Nanodiscs or amphipols for maintaining native structure

    • Bicelle formation for structural studies

  • Functional verification:

    • Transport assays in reconstituted proteoliposomes

    • Binding assays with nopaline substrate

    • Structural integrity assessment using circular dichroism

Researchers should be prepared to test multiple conditions systematically, as successful expression of membrane proteins is often empirical and protein-specific.

What statistical approaches are recommended for analyzing nocM experimental data?

When analyzing experimental data related to nocM function, researchers should employ robust statistical methodologies that account for the complexities of biological systems:

How should researchers present nocM functional data in scientific publications?

When reporting findings on nocM protein studies, researchers should structure their results according to established scientific publication guidelines. The Results section should:

  • Present findings in a logical sequence:
    "The Results section of a scientific research paper represents the core findings of a study derived from the methods applied to gather and analyze information. It presents these findings in a logical sequence without bias or interpretation from the author" . For nocM research, this typically follows the progression from basic characterization to functional analysis.

  • Include appropriate data visualizations:
    "Data presented in tables, charts, graphs, and other figures (may be placed into the text or on separate pages at the end of the manuscript)" . For nocM transport studies, this might include:

    • Kinetic plots of nopaline uptake

    • Bar graphs comparing transport rates under different conditions

    • Structural models of the protein

    • Alignment diagrams showing conserved regions across homologs

  • Provide contextual analysis:
    Include "a contextual analysis of this data explaining its meaning in sentence form" . This connects raw data to research questions without overinterpreting.

  • Report comprehensive findings:
    Include "all data that corresponds to the central research question(s)" and "all secondary findings (secondary outcomes, subgroup analyses, etc.)" . For nocM research, this means reporting both positive and negative results regarding transport function.

  • Use descriptive statements with precise language:
    When describing results, use specific descriptive phrases: "Sixty-five percent of patients over 55 responded positively to the question..." . For nocM research, this translates to precise statements like "nocM-expressing cells transported 45% more nopaline than control cells (p<0.01)."

Importantly, save interpretation of these findings for the Discussion section, maintaining objectivity in the Results.

How can nocM research be integrated into broader understanding of Agrobacterium pathogenicity?

Integrating nocM research into the broader understanding of Agrobacterium pathogenicity requires connecting protein-level mechanisms to organism-level behaviors. This integration can be approached through:

By approaching nocM research through these integrative lenses, researchers can connect mechanistic details to ecological significance and evolutionary context.

What emerging technologies could advance nocM protein research?

Several cutting-edge technologies offer promising approaches to deepen our understanding of nocM function:

  • Cryo-electron microscopy:
    Recent advances in cryo-EM allow structural determination of membrane proteins without crystallization. This could reveal the three-dimensional structure of nocM, particularly in complex with substrate or other noc operon proteins.

  • Single-molecule transport assays:
    Fluorescence-based techniques can monitor transport events at the single-molecule level, providing insights into the kinetic mechanisms and conformational changes during nopaline transport.

  • In situ structural biology:
    Techniques like cellular tomography could visualize nocM in its native membrane environment, revealing its organization and interactions within the bacterial envelope.

  • Microsecond molecular dynamics simulations:
    Computational approaches can model nocM structure, substrate binding, and conformational changes during the transport cycle, generating testable hypotheses about mechanism.

  • CRISPR interference systems:
    CRISPRi approaches allow precise temporal control of nocM expression, enabling researchers to study the consequences of nocM activity at specific stages of the infection process.

When applying these technologies, researchers should be mindful that "experimental design thus makes confidence a criterion for model choice, but that this does not necessarily correlate with a model's predictive power" . Therefore, multiple complementary approaches should be employed to build robust mechanistic models.

How do researchers address the challenges of studying membrane proteins like nocM?

Membrane proteins like nocM present specific research challenges that require specialized approaches:

  • Structural determination challenges:
    Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces. Researchers can address this through:

    • Fusion with crystallization chaperones

    • Lipidic cubic phase crystallization

    • Cryo-EM approaches that avoid crystallization entirely

    • NMR studies of isotopically labeled protein

  • Functional reconstitution:
    To study transport function in vitro, nocM must be reconstituted into artificial membrane systems:

    • Proteoliposomes with defined lipid composition

    • Planar lipid bilayers for electrophysiological studies

    • Nanodiscs for structural studies in membrane-like environment

  • Expression optimization:
    Systematic testing of expression conditions is typically required:

    • Screening multiple detergents for solubilization

    • Testing various fusion tags and their positions

    • Optimizing induction conditions (temperature, time, inducer concentration)

    • Evaluating different expression hosts

  • Stability assessment:
    Membrane proteins often have limited stability after extraction:

    • Thermal shift assays to identify stabilizing conditions

    • Engineering thermostable variants through mutagenesis

    • Identification of stabilizing ligands or lipids

  • In vivo functional assays:
    Complement structural studies with functional assays:

    • Transport assays in intact cells or vesicles

    • Protein localization using fluorescent fusions

    • In vivo crosslinking to capture interaction partners

These methodological approaches should be tailored to the specific properties of nocM, with the understanding that "a harder conceptual problem exists of how to define perturbations to more complicated classes of model, and to compare their strengths" .

What are best practices for sharing nocM research data with the scientific community?

To maximize the impact of nocM research and enhance reproducibility, researchers should follow these data sharing practices:

  • Comprehensive methodology documentation:
    "NIDM-Results provides a unified representation of mass univariate analyses including a level of detail consistent with available best practices" . While this concept comes from neuroimaging, the principle applies to nocM research: provide complete methodological details that enable reproduction.

  • Standardized data formats:
    Use "a standardized representation [that] allows authors to relay methods and results in a platform-independent regularized format that is not tied to a particular... software package" . For nocM research, this includes:

    • Raw data from transport assays in open formats

    • Protein sequences in standard FASTA format

    • Structural data in PDB format

    • Mass spectrometry data in standard formats (mzXML)

  • Data repository deposition:
    "Tools are available to export... graphs and associated files" and repositories "can import... archives" . For nocM research:

    • Deposit protein structures in the Protein Data Bank

    • Share sequence data through GenBank

    • Archive raw experimental data in appropriate repositories

    • Consider specialized repositories for specific data types

  • Complete experimental condition reporting:
    Document all relevant experimental parameters:

    • Exact strain construction details

    • Growth conditions

    • Buffer compositions

    • Instrument settings

    • Analysis parameters and software versions

  • Code and analysis pipeline sharing:
    Make available any custom code, scripts, or analysis pipelines used to process nocM data, preferably through version-controlled repositories with adequate documentation.

Adherence to these practices addresses the concern that "only a tiny fraction of the data and metadata produced by [a] study is finally conveyed to the community" which "not only hinders the reproducibility... but also impairs future meta-analyses" .

How can researchers ensure reproducibility in nocM functional studies?

Ensuring reproducibility in nocM functional studies requires systematic attention to several key aspects:

  • Explicit material verification:

    • Verify the identity of the nocM construct through sequencing

    • Document the precise genotype of bacterial strains

    • Characterize protein preparations (purity, activity)

    • Validate the quality of substrates and reagents

  • Standardized protocols:

    • Develop and share detailed step-by-step protocols

    • Include all buffer compositions and reaction conditions

    • Specify equipment models and settings

    • Document software versions and parameters

  • Statistical robustness:

    • Define sample sizes based on power analysis

    • Establish clear inclusion/exclusion criteria

    • Report all statistical tests and their assumptions

    • Include raw data alongside processed results

  • Biological validation:

    • Use multiple complementary assays to confirm findings

    • Include appropriate positive and negative controls

    • Validate key findings using independent approaches

    • Test across different experimental conditions

  • Transparent reporting:
    When writing results, ensure "the findings include data presented in tables, charts, graphs, and other figures... a contextual analysis of this data explaining its meaning in sentence form... all data that corresponds to the central research question(s)... all secondary findings" .

By adhering to these practices, researchers can address the concern that "this lack of transparency not only hinders the reproducibility of results but also impairs future meta-analyses" in the field of Agrobacterium research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.