Recombinant Agrobacterium tumefaciens Probable intracellular septation protein A (Atu2692)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Agrobacterium tumefaciens Probable Intracellular Septation Protein A (Atu2692)

Recombinant Agrobacterium tumefaciens Probable Intracellular Septation Protein A (Atu2692) is a bacterial protein engineered for research applications. This protein, encoded by the Atu2692 gene (synonyms: yciB, AGR_C_4880.1), is associated with intracellular septation—a critical process in bacterial cell division. The recombinant variant is expressed in Escherichia coli with an N-terminal His-tag for purification and detection purposes .

Protein Interaction Studies

Atu2692 serves as a tool to investigate bacterial cell division mechanisms. Its recombinant form enables:

  • Structural analysis: Mapping transmembrane domains and topology .

  • Functional assays: Testing interactions with divisome components (e.g., FtsZ, FtsA) .

Biotechnological Uses

  • ELISA development: Commercial kits utilize recombinant Atu2692 for antibody validation (e.g., Cusabio’s CSB-CF844919AYS) .

  • Host-pathogen studies: Probing A. tumefaciens membrane dynamics during plant infection .

Expression and Purification

  • Vector system: Full-length Atu2692 cloned into a His-tagged vector for high-yield expression in E. coli .

  • Lyophilization: Stabilized in trehalose to prevent aggregation during storage .

Stability Notes:

  • Avoid repeated freeze-thaw cycles; aliquot for single-use portions .

  • Short-term storage (1 week) at 4°C is feasible for working solutions .

Comparative Analysis with Agrobacterium Secretion Systems

While Atu2692 is distinct from well-characterized virulence factors like T4SS/T6SS, its membrane localization suggests potential interplay with secretion machinery. For example:

  • T4SS: Facilitates DNA transfer to plant cells .

  • T6SS: Mediates interbacterial competition .
    Atu2692’s role in septation may indirectly influence secretion system assembly or spatial organization .

Future Research Directions

  • Genetic knockouts: Assess Atu2692 deletion strains for septation defects .

  • Cryo-EM studies: Resolve atomic-level structure to identify functional domains .

  • Plant interaction assays: Test if Atu2692 modulates A. tumefaciens pathogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
yciB; Atu2692; AGR_C_4880.1; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
Atu2692
Target Protein Sequence
MVAEISPLLKFVLELGPLMVFFFANSRGEWLASTFPVLTEFGGPIFIATGLFMIATATAL TVSWILTRKLPIMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGVILLGGLFFGQ SLLGYVFNSAFKLTDEGWRKLTLRWGVFFLFLAVLNEVVWRMFTTDTWVAFKVWGTMPIT IIFTMAQMPFVMRHSVEPLGKDEK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

STRING: 176299.Atu2692

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Atu2692 and what are its basic properties?

Atu2692 is a probable intracellular septation protein from Agrobacterium tumefaciens strain C58 / ATCC 33970. It is a full-length protein consisting of 204 amino acids with the UniProt accession number Q8UC06. The protein is characterized by its highly hydrophobic nature, suggesting it may be a membrane-associated protein involved in cellular septation processes. The full amino acid sequence is: MVAEISPLLKFVLELGPLMVFFFANSRGEWLASTFPVLTEFGGPIFIATGLFMIATATALLTVSWILTRKLPIMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGVILLGGLFFGQSLLGYVFNSAFKLTDEGWRKLTLRWGVFFLFLAVLNEVVWRMFTTDTWVAFKVWGTMPITIIFTMAQMPFVMRHSVEPLGKDEK .

How is Atu2692 related to other bacterial intracellular septation proteins?

Based on functional characterization of homologous proteins, Atu2692 appears to share similarities with the intracellular septation protein A (ispA) identified in Shigella flexneri. Research on ispA has shown that this gene encodes a small (21 kDa), highly hydrophobic protein essential for bacterial cell division and virulence. When ispA is mutated in Shigella, bacteria exhibit defects in cell division, resulting in long filamentous bacteria lacking proper septa . Given the functional annotation of Atu2692 as a "probable intracellular septation protein A," it likely plays a similar role in A. tumefaciens cell division processes, although direct experimental evidence confirming this specific function in A. tumefaciens is still needed.

What expression systems are recommended for producing recombinant Atu2692?

For research-grade production of recombinant Atu2692, E. coli-based expression systems are generally recommended due to their efficiency and cost-effectiveness. When expressing highly hydrophobic membrane proteins like Atu2692, consider these methodological approaches:

  • Use expression vectors with tightly controlled inducible promoters (e.g., T7 or araBAD)

  • Optimize expression conditions with lower induction temperatures (16-25°C)

  • Consider fusion tags that enhance solubility (e.g., MBP, SUMO, or Thioredoxin)

  • For membrane proteins, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression may yield better results

The commercially available recombinant Atu2692 is typically supplied in a storage buffer containing Tris-based buffer with 50% glycerol optimized for protein stability .

What are the optimal storage and handling conditions for recombinant Atu2692?

Recombinant Atu2692 requires specific storage and handling conditions to maintain structural integrity and biological activity. The recommended storage protocol includes:

  • For long-term storage: Store at -20°C or preferably at -80°C

  • For working solutions: Prepare small aliquots and store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as these can significantly degrade protein structure and function

  • Store in buffer containing 50% glycerol and Tris-based components optimized for protein stability

  • When thawing, do so gradually on ice to prevent protein denaturation

What methods can be used to assess the structural integrity of purified Atu2692?

To verify the structural integrity of purified Atu2692 for experimental use, researchers should employ multiple complementary techniques:

  • SDS-PAGE analysis: Confirms the molecular weight (approximately 21-23 kDa) and purity

  • Western blotting: Verifies protein identity using antibodies against the protein or fusion tags

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure elements, particularly important for membrane proteins

  • Size exclusion chromatography: Evaluates aggregation state and homogeneity

  • Mass spectrometry: Confirms protein identity and integrity through peptide mass fingerprinting

For membrane proteins like Atu2692, additional techniques such as detergent screening and thermal stability assays may provide valuable information about proper folding in membrane-mimetic environments.

What functional assays can be used to characterize Atu2692's role in septation?

Based on knowledge of similar septation proteins, researchers can employ these functional characterization approaches:

  • Bacterial complementation assays: Using Atu2692 to rescue septation defects in mutant strains

  • Fluorescence microscopy with GFP-tagged Atu2692 to visualize subcellular localization during cell division

  • Bacterial two-hybrid systems to identify protein interaction partners involved in the septation process

  • In vitro membrane binding assays to characterize interactions with lipid bilayers

  • Electron microscopy to examine effects on septum formation and bacterial morphology

When designing these assays, researchers should consider using both homologous expression in A. tumefaciens and heterologous expression in model organisms like E. coli to provide complementary insights into protein function.

How does Atu2692 potentially contribute to A. tumefaciens virulence and host interactions?

While the specific role of Atu2692 in A. tumefaciens virulence has not been directly characterized in the available literature, insights can be drawn from research on homologous proteins. The ispA protein in Shigella flexneri demonstrates that intracellular septation proteins can significantly impact bacterial virulence through multiple mechanisms:

  • Cell division regulation during host infection

  • Influence on bacterial morphology affecting host cell invasion

  • Potential roles in actin polymerization necessary for intercellular spreading

By analogy, Atu2692 may affect A. tumefaciens-plant interactions by regulating bacterial division during the infection process. Unlike the protein encoded by Atu6002, which is directly involved in modifying plant cell responses to hormones like auxin , Atu2692 likely plays an indirect role in virulence by maintaining proper bacterial cell division during the infection process. Research questions should focus on bacterial cell biology during plant-microbe interactions rather than direct effects on plant signaling pathways.

What structural features of Atu2692 are critical for its membrane association and function?

Based on sequence analysis and comparison with similar proteins, several structural features of Atu2692 warrant investigation:

  • Hydrophobic transmembrane domains: The amino acid sequence indicates multiple potential membrane-spanning regions that likely anchor the protein within the bacterial membrane

  • Conserved functional motifs: Identification of sequence motifs shared with other septation proteins may reveal functional domains

  • Protein-protein interaction interfaces: Regions that may mediate interactions with other components of the bacterial division machinery

Researchers can employ site-directed mutagenesis approaches targeting these key structural elements, followed by functional assays, to determine which regions are essential for proper localization and function. Structural prediction analysis suggests Atu2692 may contain 4-6 transmembrane helices typical of membrane-integrated septation proteins.

How do environmental factors affect Atu2692 expression and function in A. tumefaciens?

While specific data on Atu2692 regulation is limited, research on bacterial septation proteins suggests several environmental factors that may influence expression and function:

Environmental FactorPotential Effect on Atu2692Experimental Approach
Growth phaseDifferential expression during logarithmic vs. stationary phaseqRT-PCR analysis across growth phases
Nutrient availabilityAltered expression under nutrient limitationTranscriptomics under various media conditions
TemperatureFunctional changes affecting membrane fluidity and protein conformationGrowth and function assays at different temperatures
pHAltered protein conformation and membrane interactionsIn vitro stability and membrane binding assays at varying pH
Plant-derived signalsPotential regulation during plant-microbe interactionsExpression analysis during plant infection process

Researchers designing experiments to investigate these factors should include appropriate controls and consider the physiological relevance of the tested conditions to A. tumefaciens ecology and pathogenesis.

What control proteins should be included when studying Atu2692 function?

When designing experiments to study Atu2692 function, include these controls:

  • Positive controls:

    • Related septation proteins with confirmed function (e.g., FtsZ, FtsA from model organisms)

    • Homologous proteins from related bacteria (e.g., ispA from related Rhizobiales)

    • Wild-type Atu2692 (when testing mutant variants)

  • Negative controls:

    • Inactive mutant versions of Atu2692 (e.g., site-directed mutants in conserved residues)

    • Unrelated membrane proteins of similar size

    • Empty vector controls for expression studies

  • Specificity controls:

    • Non-septation membrane proteins from A. tumefaciens

    • Cytoplasmic proteins involved in other cellular processes

These controls help validate experimental findings and distinguish specific effects of Atu2692 from general membrane protein phenotypes or expression artifacts.

How can researchers generate and validate knockout or knockdown models for Atu2692 studies?

To investigate Atu2692 function through loss-of-function approaches, researchers can employ these methodological strategies:

  • CRISPR-Cas9 gene editing:

    • Design guide RNAs targeting Atu2692 coding sequence

    • Include screening for off-target effects

    • Validate knockouts by sequencing and protein expression analysis

  • Homologous recombination approaches:

    • Design constructs with antibiotic resistance cassettes flanked by Atu2692 homology regions

    • Screen transformants for proper integration

    • Create complementation strains expressing wild-type Atu2692 to confirm phenotype specificity

  • Conditional knockdown strategies (if knockout is lethal):

    • Implement inducible antisense RNA expression

    • Use destabilizing domain fusion technology for protein-level depletion

    • Employ temperature-sensitive variants for functional studies

Validation should include multiple approaches:

  • Genomic PCR verification

  • RT-qPCR for transcript level analysis

  • Western blotting to confirm protein depletion

  • Phenotypic analysis including growth curves, microscopy for cell morphology, and cell division dynamics analysis

What are the challenges in comparing in vitro and in vivo findings for Atu2692 function?

Researchers studying Atu2692 should anticipate and address several challenges when reconciling in vitro biochemical data with in vivo functional observations:

  • Membrane protein context:

    • In vitro studies often require detergents or artificial membrane systems that may not accurately mimic the native membrane environment

    • The lipid composition of E. coli expression systems differs from A. tumefaciens

  • Protein interaction networks:

    • In vitro studies may miss critical interaction partners present only in the native cellular context

    • Overexpression systems may create artificial interactions not relevant in vivo

  • Physiological dynamics:

    • Static in vitro assays cannot capture the dynamic nature of septation during the cell cycle

    • Cell division regulation differs between laboratory growth conditions and infection contexts

To address these challenges, employ complementary approaches:

  • Use multiple membrane mimetics in vitro (detergents, nanodiscs, liposomes)

  • Validate interactions with co-immunoprecipitation from native cells

  • Confirm localization patterns with fluorescence microscopy in live cells

  • Combine biochemical with genetic and cell biological approaches

How should researchers interpret conflicting data regarding Atu2692 localization?

When faced with contradictory results regarding Atu2692 subcellular localization, consider these methodological factors:

  • Tagging effects:

    • C-terminal vs. N-terminal fusion tags may differentially affect membrane insertion

    • Tag size and properties can disrupt proper localization

    • Solution: Compare multiple tagging strategies and validate with antibodies against the native protein

  • Fixation artifacts:

    • Chemical fixatives can disrupt membrane structures

    • Solution: Compare live-cell imaging with fixed samples, use multiple fixation protocols

  • Growth conditions:

    • Protein localization may change with growth phase or environmental conditions

    • Solution: Standardize growth conditions and examine localization across different phases

  • Detection sensitivity:

    • Low-abundance membrane proteins may require signal enhancement

    • Solution: Optimize exposure settings, use signal amplification methods, consider super-resolution microscopy

When publishing, transparently report all experimental conditions and acknowledge limitations of each approach to allow proper evaluation of seemingly conflicting data.

What are common pitfalls in protein-protein interaction studies involving Atu2692?

Researchers investigating Atu2692 interactions should be aware of these common technical challenges and interpretative pitfalls:

  • False positives in pull-down assays:

    • Hydrophobic membrane proteins often exhibit non-specific interactions

    • Detergent choice can dramatically affect interaction profiles

    • Solution: Use stringent controls, validate with multiple methods, consider crosslinking approaches

  • False negatives due to membrane context:

    • Transmembrane interactions may be disrupted by solubilization

    • Solution: Use membrane-based two-hybrid systems, in situ proximity labeling (BioID, APEX)

  • Overexpression artifacts:

    • Non-physiological abundance can drive artificial interactions

    • Solution: Use inducible systems with titrated expression levels, validate at endogenous levels

  • Context-dependent interactions:

    • Some interactions may only occur during specific cell cycle phases or under specific conditions

    • Solution: Synchronize cultures or use single-cell approaches to capture temporal dynamics

A multi-method validation approach combining in vitro (pull-downs, surface plasmon resonance) and in vivo (FRET, BiFC, co-localization) techniques provides the most robust evidence for genuine protein-protein interactions.

How can researchers distinguish between direct and indirect effects when studying Atu2692 mutants?

When analyzing phenotypes associated with Atu2692 mutations or knockouts, use these approaches to distinguish direct from indirect effects:

  • Complementation analysis:

    • Wild-type gene restoration should rescue direct effects

    • Timing of complementation can reveal primary vs. secondary effects

    • Domain-specific complementation can identify critical functional regions

  • Temporal analysis:

    • Document the sequence of phenotypic changes

    • Early-occurring phenotypes are more likely direct consequences

    • Time-course experiments can establish causal relationships

  • Suppressor screening:

    • Identify mutations that rescue Atu2692 deficiency

    • Suppressors often function in the same pathway or process

  • Biochemical validation:

    • Reconstitute activities in purified systems

    • Direct effects should be reproducible with purified components

  • Specificity controls:

    • Compare phenotypes with mutations in functionally related and unrelated genes

    • Similar septation proteins should show overlapping but distinct phenotypic signatures

What emerging technologies could advance our understanding of Atu2692 function?

Several cutting-edge technologies hold promise for elucidating Atu2692 function and regulation:

  • Cryo-electron microscopy:

    • Potential for high-resolution structural insights of membrane-embedded Atu2692

    • Can capture different functional states if sample preparation is optimized

  • Advanced imaging techniques:

    • Super-resolution microscopy to precisely localize Atu2692 during cell division

    • Single-molecule tracking to monitor dynamics in live cells

    • Correlative light and electron microscopy to connect function with ultrastructure

  • Genomic approaches:

    • CRISPRi screening to identify genetic interactions

    • Tn-seq for comprehensive phenotypic profiling under various conditions

    • Ribosome profiling to analyze translational regulation

  • Structural proteomics:

    • Hydrogen-deuterium exchange mass spectrometry to map protein interactions

    • Crosslinking mass spectrometry to capture transient interactions

    • Protein painting approaches for mapping interaction surfaces

These technologies, when applied to Atu2692 research, can provide unprecedented insights into protein function within the complex cellular environment of A. tumefaciens.

How might research on Atu2692 inform broader questions in bacterial cell biology?

Studies on Atu2692 have the potential to address fundamental questions in bacterial cell biology:

  • Evolution of bacterial cell division mechanisms:

    • Comparing Atu2692 with homologs across bacterial lineages can reveal evolutionary constraints and adaptations in septation processes

    • Functional conservation versus divergence may indicate essential versus specialized roles

  • Coordination between bacterial morphogenesis and pathogenesis:

    • Understanding how septation proteins like Atu2692 influence virulence could reveal connections between basic cellular processes and pathogenicity

    • Similar to findings with ispA in Shigella, where cell division defects directly impaired intercellular spreading

  • Membrane protein organization principles:

    • Atu2692 localization and dynamics could provide insights into how bacteria organize membrane proteins spatially and temporally

    • Potential contribution to understanding bacterial membrane microdomains

  • Environmental adaptation of essential processes:

    • How bacteria modulate core cellular machinery like septation in response to changing environments, particularly during host interaction

What interdisciplinary approaches could yield novel insights into Atu2692 biology?

Integrating methods and concepts from multiple disciplines could provide unique perspectives on Atu2692 function:

  • Systems biology approaches:

    • Network analysis combining transcriptomics, proteomics, and metabolomics data

    • Mathematical modeling of septation dynamics incorporating Atu2692 function

    • Identification of emergent properties not evident from reductionist approaches

  • Synthetic biology strategies:

    • Engineered variants with novel functionalities to probe mechanism

    • Minimal septation systems reconstituted in artificial cells

    • Directed evolution to identify functionally important residues

  • Comparative biology:

    • Functional analysis across diverse bacterial species

    • Examination of Atu2692 homologs in non-pathogenic versus pathogenic contexts

    • Evolutionary analysis of sequence conservation patterns

  • Plant-microbe interaction perspectives:

    • Investigation of Atu2692 regulation during different stages of plant infection

    • Plant immune response effects on bacterial septation processes

    • Comparison with other plant-associated bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.