Recombinant Agrobacterium tumefaciens Protein virB2 (virB2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

VirB2 is the major pilin subunit of the T-pilus, a filamentous structure essential for initiating bacterial-plant cell contact during A. tumefaciens infection . Recombinant virB2 is produced in E. coli as a truncated, His-tagged protein (20–121 amino acids), corresponding to the mature pilin form .

PropertyDetail
UniProt IDP17792 (nopaline strain) / P05351 (octopine strain)
Molecular Weight~7.2 kDa (processed form)
TagN-terminal His-tag
Expression HostE. coli
Purity>90% (SDS-PAGE)

Function in Plant Transformation

VirB2 mediates two key processes:

  1. T-Pilus Assembly:

    • Forms the extracellular pilus, facilitating bacterial adhesion to plant cells .

    • VirB5 interacts with virB2 to stabilize the pilus structure .

  2. Interactions with Plant Proteins:

    • BTI1, BTI2, BTI3: Plant proteins that bind virB2’s C-terminal region, modulating transformation efficiency . Overexpression of BTI1 reduces A. tumefaciens infection rates .

    • AtRAB8: A membrane-associated GTPase interacting with virB2, potentially regulating membrane trafficking during DNA transfer .

Plant ProteinInteraction TypeFunctional ImpactSource
BTI1Direct binding (in vitro)Reduces transformation efficiency
AtRAB8Membrane-associated GTPaseFacilitates substrate translocation

Production and Applications

Production Protocol:

  • Expression: Induced in E. coli under optimized conditions (e.g., IPTG induction).

  • Purification: Utilizes nickel-affinity chromatography (His-tag) .

  • Storage: Lyophilized at -20°C/-80°C in Tris/PBS buffer with 6% trehalose .

Applications:

  1. Basic Research:

    • Studying T4SS assembly and pilin polymerization .

    • Mapping virB2-plant protein interactions (e.g., BTI1/AtRAB8) .

  2. Biotechnological Tools:

    • Enhancing plant transformation efficiency (e.g., via BTI protein manipulation) .

    • Developing novel delivery systems for genetic engineering.

Research Findings and Insights

  • Uncoupling Mutations: Some virB2 mutations (e.g., amino acid substitutions) block T-pilus formation but retain DNA transfer capability, highlighting the pilus’s auxiliary role in infection .

  • Species-Specific Efficiency: VirB2 interactions with plant proteins like RTNLB1 and AtRAB8 influence transformation success rates, particularly in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
virB2; Protein virB2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-121
Protein Length
Full Length of Mature Protein
Species
Agrobacterium tumefaciens (strain 15955)
Target Names
virB2
Target Protein Sequence
MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGS
Uniprot No.

Target Background

Function
VirB proteins are believed to function at the bacterial surface, playing a crucial role in directing T-DNA transfer to plant cells.
Gene References Into Functions
  1. Evidence from coimmunoprecipitation, supporting VirB2-VirB4 complex formation, suggests that VirB4 acts as a dislocation motor, extracting pilins from the inner membrane during T4SS biogenesis. PMID: 20656905
Protein Families
VirB2 family
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium tumefaciens protein virB2?

VirB2 is a processed pilin-like protein encoded by the virB2 gene in Agrobacterium tumefaciens. It functions as the major component of the T-pilus, a critical structure of the type IV secretion system (T4SS) that mediates the transfer of T-DNA and virulence proteins from bacteria to plant cells. The protein undergoes processing from a 12.3-kDa precursor to a 7.2-kDa mature form before incorporation into the T-pilus structure .

What is the molecular structure of processed virB2?

Recent cryo-EM structural studies have revealed that virB2 subunits are not cyclic in structure as previously suggested by mass spectrometry data. Instead, the protein chain forms a complex arrangement of helices: starting from the N-terminus, the chain runs toward the lumen and forms two helices – α1 and α2. The chain then turns in the lumen and returns outward via two helices α3a and α3b. Residues along the entire length of each protein chain engage in extensive inter-protein or inter-lipid interactions with multiple proteins and lipids .

What plant proteins interact with virB2?

Using yeast two-hybrid and in vitro assays, researchers have identified two classes of Arabidopsis proteins that interact with virB2:

  • VirB2-interacting proteins (BTI): Three related proteins (BTI1, BTI2, and BTI3) with previously unknown functions

  • Arabidopsis GTPase AtRAB8

These interactions were confirmed through in vitro GST pull-down assays, which demonstrated that all three BTI proteins interacted with the GST-VirB2 fusion protein but not with GST alone. Additionally, the three BTI proteins were found to interact with each other and with themselves in vitro, as well as with either the GTP or GDP form of GST-AtRAB8, suggesting the possibility of complex formation in plants .

How is virB2 processed in Agrobacterium?

VirB2 is initially produced as a 12.3-kDa unprocessed precursor (VirB2p) that undergoes processing to form a 7.2-kDa mature protein (VirB2m). Western blot analysis has shown that both the precursor and mature forms are detected within bacterial cells, but only the processed form is found extracellularly in the T-pilus. Processing involves cleavage near an Ala-Glu site. Mutations affecting this processing can destabilize the protein or prevent proper T-pilus formation .

How can recombinant virB2 expression systems be constructed for mutational studies?

To construct a virB2 expression system for mutational analysis, researchers have successfully used the following protocol:

  • Clone a DNA fragment containing the virB promoter and virB1, virB2, and virB3 genes (virBp-B1-B2-B3) into a broad host-range plasmid (e.g., pRL662)

  • Generate a virB2 in-frame deletion mutant (ΔvirB2) from the A. tumefaciens wild-type strain (typically C58), deleting amino acid residues 4 to 113

  • Use site-directed mutagenesis with appropriate primers to introduce specific amino acid substitutions in the virB2 gene

  • Transform the ΔvirB2 strain with plasmids carrying wild-type or mutant virB2

  • Confirm sequences to ensure no additional mutations occurred during the process

This system allows for complementation testing and expression of mutant virB2 variants in their native context .

What methods are used to assess T-pilus formation and virB2 localization?

Researchers employ multiple complementary techniques to evaluate T-pilus formation and virB2 localization:

  • Western blot analysis of protein fractions:

    • Grow A. tumefaciens cells under virulence-inducing conditions

    • Harvest and resuspend cells in acidic phosphate buffer (pH 5.3)

    • Centrifuge to obtain the S1 fraction (cell-free supernatant)

    • Resuspend cell pellets and subject to shearing to obtain the S2 fraction enriched for T-pilus

    • Analyze fractions by SDS-PAGE and western blotting with anti-virB2 antibodies

  • Transmission electron microscopy (TEM):

    • Negatively stain A. tumefaciens cells with uranyl acetate

    • Examine by TEM to observe T-pilus structures, which appear as rigid or semi-rigid long filaments (500 nm to 2 µm) approximately 10-nm wide

  • Tumorigenesis assays:

    • Inoculate plant tissues (e.g., tomato stems, potato tuber discs, or Kalanchoe leaves) with A. tumefaciens strains

    • Evaluate tumor formation after an appropriate incubation period

    • Compare virulence of mutant strains with wild-type controls

How can virB2-plant protein interactions be studied experimentally?

Multiple approaches can be used to investigate virB2-plant protein interactions:

  • Yeast two-hybrid screening:

    • Use the C-terminal–processed portion of virB2 protein as bait

    • Screen plant cDNA libraries (e.g., from Arabidopsis thaliana)

    • Perform directed assays to confirm specific interactions

  • In vitro GST pull-down assays:

    • Express GST-virB2 fusion proteins and link to glutathione-sepharose beads

    • Incubate with lysates from E. coli expressing T7-tagged plant proteins

    • After extensive washing, elute bound proteins and analyze by western blotting with anti-T7 antibodies

    • Use GST alone as a negative control

  • Functional transformation assays:

    • Preincubate Agrobacterium with purified plant proteins (e.g., GST-BTI1)

    • Assess effects on transformation efficiency of plant cells

    • Alternatively, generate transgenic plants with altered expression of the interacting proteins and evaluate transformation susceptibility

What are the critical amino acid residues in virB2 for T-pilus formation and virulence?

Extensive mutational analysis has identified key amino acid residues in virB2 that affect protein stability, T-pilus formation, and virulence. The following table summarizes the effects of selected virB2 mutations:

MutationExtracellular virB2VirulenceT-pilus FormationPhenotype Category
P44AReduced++ExB2+/Vir+
A47V---ExB2-/Vir-
S49AReduced++ExB2+/Vir+
D55A-+-ExB2-/Vir+
I85A-+-ExB2-/Vir+
R91A---ExB2-/Vir-
L94A-+-ExB2-/Vir+
M107A-+-ExB2-/Vir+
A110G-+-ExB2-/Vir+
G119AReduced++ExB2+/Vir+

The R91 residue is particularly critical as it is the only positively charged residue within the cytoplasmic domain. Substitution of Arginine 91 with Alanine (R91A) or Glutamic Acid (R91E) leads to protein instability, with no detectable VirB2 by western blot, complete absence of T-pilus formation, and loss of virulence .

Why are uncoupling mutations particularly important for understanding virB2 function?

Five virB2 variants (D55A, I85A, L94A, M107A, A110G) exhibit an uncoupling phenotype where T-pilus formation is abolished but virulence is maintained (ExB2-/Vir+ phenotype). These mutants provide important insights into virB2 function:

  • They demonstrate that while virB2 is essential for T4SS function, the assembled T-pilus structure itself may not be absolutely required for T-DNA transfer

  • Despite maintaining wild-type levels of tumorigenesis on tomato stems and potato tuber discs, these mutants show highly attenuated transient transformation efficiency in Arabidopsis seedlings

  • This suggests the T-pilus enhances transformation efficiency, particularly in certain plant species or tissues, likely by facilitating initial bacterial attachment to host cells

  • The uncoupling phenotype indicates distinct structural requirements for virB2's role in T-pilus formation versus its role in substrate transfer through the T4SS

What is the significance of the R91 residue in virB2 structure and function?

The R91 residue plays a critical role in virB2 stability and function:

  • R91 is the only positively charged residue within the cytoplasmic domain of virB2

  • In the cryo-EM structure, R91 is located in the luminal loop (residues 89-93) that separates the α2 and α3a helices

  • The position of the R91 sidechain is not well resolved in the map density, suggesting flexibility

  • Mutations R91A and R91E lead to complete protein instability, with no detectable virB2 by western blot

  • The instability likely results from disruption of the "positive inside rule" of membrane protein topology

  • Both mutations abolish virulence in plant infection assays, highlighting the essential nature of this residue

  • The S93A mutation, adjacent to R91, results in reduced protein accumulation but maintains some function

How does virB2 contribute to the host plant DNA damage response during transformation?

Recent research has revealed interesting connections between Agrobacterium infection and the plant DNA damage response:

  • Agrobacterium infection elevates the transcription of DNA damage repair genes in host plants, including NAC82, KU70, and AGO2

  • This transcriptional activation requires the transport of Vir effector proteins (VirD2, VirD5, VirE2, VirE3, and VirF) into the host cell

  • A mutation in virB5, which encodes a minor component of the T-pilus, negates this transcriptional activation

  • Since virB2 is a major component of the T-pilus and essential for T4SS function, mutations disrupting virB2 function would likely have similar effects on the host DNA damage response

  • This suggests that virB2, as part of the T4SS machinery, indirectly contributes to manipulating the host DNA repair machinery, potentially to facilitate T-DNA integration

How can cryo-electron microscopy contribute to understanding virB2 structure and function?

Cryo-EM has provided significant insights into virB2 structure that were not possible with previous techniques:

  • The technique revealed that virB2 subunits are not cyclic in the T-pilus as previously reported from mass spectrometry

  • It identified the precise arrangement of four helices (α1, α2, α3a, and α3b) and their orientation in the T-pilus

  • The structure showed a luminal loop (residues 89-93) containing the critical R91 residue

  • The cryo-EM data allowed mapping of known functional mutations onto the 3D structure to better understand structure-function relationships

  • This structural information can guide future mutagenesis studies by identifying potentially important residues at interfaces or in critical structural elements

What is the broader significance of virB2 research for biotechnology applications?

Understanding virB2 structure and function has significant implications for biotechnology:

  • Improved plant transformation systems:

    • Engineering virB2 variants with enhanced transformation efficiency

    • Developing more host-specific transformation systems by altering virB2-plant protein interactions

    • Creating minimal T4SS systems that maintain transformation function without T-pilus formation

  • Novel delivery systems for biomolecules:

    • Utilizing the T4SS as a delivery system for proteins, RNA, or other molecules to plant cells

    • Engineering the virB2 protein to target specific cell types or tissues

  • Agricultural applications:

    • Developing strategies to block virB2 function to protect plants from Agrobacterium infection

    • Engineering resistance to crown gall disease in economically important crops

  • Fundamental understanding of horizontal gene transfer:

    • Elucidating mechanisms of inter-kingdom DNA transfer

    • Understanding the evolution of type IV secretion systems

What are current knowledge gaps in virB2 research?

Despite significant progress, several aspects of virB2 biology remain poorly understood:

  • The precise mechanism by which virB2 contributes to T-DNA transfer remains unclear, particularly in mutants that maintain virulence without T-pilus formation

  • The exact nature of the interactions between virB2 and plant proteins during the initial stages of transformation

  • The complete structure of the T4SS channel and how virB2 integrates into this complex

  • The potential role of virB2 in determining host specificity of different Agrobacterium strains

  • How virB2 and the T-pilus interface with the plant cell wall during infection

What emerging technologies could advance virB2 research?

Several cutting-edge approaches could significantly advance our understanding of virB2:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize T-pilus-host interactions in situ

    • Live-cell imaging to track virB2 during the infection process

  • Structural biology approaches:

    • Integrative structural biology combining cryo-EM, X-ray crystallography, and computational modeling to resolve the complete T4SS structure

    • Hydrogen-deuterium exchange mass spectrometry to study dynamic aspects of virB2 interactions

  • Systems biology approaches:

    • Multi-omics studies to understand the global impact of virB2 mutations on Agrobacterium and host cells

    • Network analysis of protein-protein interactions during transformation

  • Synthetic biology tools:

    • CRISPR-based genome editing to create precise virB2 variants in Agrobacterium

    • Designing minimal T4SS systems with defined functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.