Recombinant Agrobacterium tumefaciens Protein virB3 (virB3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Agrobacterium tumefaciens Protein VirB3

Recombinant Agrobacterium tumefaciens VirB3 is a genetically engineered form of the VirB3 protein, a critical component of the Type IV secretion system (T4SS) responsible for transferring T-DNA and effector proteins into plant cells during Agrobacterium-mediated genetic transformation. This protein plays a structural and functional role in assembling the T-pilus and facilitating intercellular DNA transfer .

Biological Role of VirB3 in Agrobacterium tumefaciens

VirB3 is essential for:

  • T-pilus assembly: Required for the formation of the conjugation pilus that mediates bacterial attachment to plant cells .

  • T-DNA secretion: Facilitates the transfer of tumor-inducing (Ti) plasmid DNA into host cells .

  • Stabilization of VirB complexes: Interacts with VirB4, VirB7, and VirB8 to maintain structural integrity of the secretion apparatus .

Membrane Topology

  • Contains two transmembrane domains with cytoplasmic N- and C-termini, as demonstrated by PhoA/GFP fusion assays .

  • Localizes to the inner membrane and bacterial cell poles .

Sequence Conservation

  • Encoded by Ti plasmids (e.g., pTiA6NC, pTiBo542, pTiC58) with sequence variations affecting protein interactions .

Recombinant Production and Purification

While specific protocols for recombinant VirB3 production are not detailed in the provided sources, standard methodologies likely involve:

  1. Cloning: Insertion of the virB3 gene into expression vectors (e.g., pET systems).

  2. Expression: Induction in E. coli or Agrobacterium hosts under controlled conditions.

  3. Purification: Affinity chromatography using His-tags or other fusion partners.

Genetic Requirements for VirB3 Activity

VirB ProteinRole in VirB3 Stability/FunctionExperimental Evidence
VirB4Stabilizes VirB3 via ATPase activityCo-fractionation assays
VirB7/VirB8Form ternary complex for VirB3 stabilityCo-immunoprecipitation
VirB2Pilin subunit colocalizes with VirB3Inner membrane association

Conjugation Efficiency in virB Mutants

Data from virB-mediated conjugal transfer assays (PNAS, 1998) :

Mutant StrainTransconjugants/Recipient (Relative to Wild-Type)
ΔvirB30.06%
ΔvirB40.28%
ΔvirB70%
ΔvirB80.23%

Interaction Network and Stabilization Mechanisms

  • VirB3-VirB4 Interaction: Essential for preventing proteolytic degradation; VirB4 ATPase activity regulates VirB3 levels .

  • VirB7/VirB8 Dependence: Co-expression of both proteins is required for VirB3 accumulation, as shown in complementation assays .

  • Polar Localization: GFP-tagged VirB3 localizes to cell poles, suggesting spatial coordination in T4SS assembly .

Applications in Genetic Engineering

  • Plant transformation: VirB3-deficient strains show reduced T-DNA transfer efficiency, highlighting its utility in optimizing transformation protocols .

  • Protein interaction studies: Recombinant VirB3 serves as a tool to dissect T4SS machinery in Agrobacterium and related pathogens .

Challenges and Research Gaps

  • Structural resolution: No high-resolution crystal structures of VirB3 are available .

  • Host-specific adaptations: Functional differences between VirB3 homologs in octopine/nopaline Ti plasmids remain underexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
virB3; Protein virB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Agrobacterium tumefaciens (strain 15955)
Target Names
virB3
Target Protein Sequence
MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARL IVERDYNAASVVLLFLRTAGRSIDSAVWGGATVSPNPIRVPPRGRGMV
Uniprot No.

Target Background

Function
VirB proteins are believed to function at the bacterial surface, playing a crucial role in directing T-DNA transfer to plant cells.
Protein Families
VirB3 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is virB3 and what role does it play in Agrobacterium tumefaciens?

VirB3 is a small, 108-amino acid protein that functions as a critical component of the Type IV Secretion System (T4SS) in Agrobacterium tumefaciens. This secretion system is essential for the bacterium's ability to transfer DNA and proteins to plant cells during infection, ultimately leading to crown gall disease. VirB3 appears to be an integral membrane protein that participates in the formation of the secretion channel complex . The protein's membrane localization suggests it plays a structural role in assembling the transport machinery that enables the transfer of T-DNA and effector proteins into host cells.

What are the physical and biochemical properties of recombinant virB3?

Recombinant virB3 is a small protein with the following characteristics:

PropertyDescription
Amino acid length108 amino acids (full length)
SequenceMNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARLIVERDYNAASVVLLFLRTAGRSIDSAVWGGATVSPNPIRVPPRGRGMV
Molecular topologyMembrane protein with hydrophobic regions
Expression systemSuccessfully expressed in E. coli with N-terminal His-tag
Storage conditions-20°C/-80°C, avoiding repeated freeze-thaw cycles
ReconstitutionIn deionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol

The protein contains hydrophobic segments consistent with transmembrane domains, which explains its membrane localization in bacterial cells .

How does virB3 relate to other Vir proteins in the Type IV secretion machinery?

VirB3 functions as part of the VirB/VirD4 T4SS complex, which includes numerous other proteins (VirB1-VirB11 and VirD4). This secretion system is responsible for translocating both T-DNA and virulence proteins such as VirE2 and VirF into plant cells during infection. While VirB3 is a structural component of the secretion apparatus, other Vir proteins serve different functions – VirD2 covalently binds to the T-DNA, VirE2 coats single-stranded DNA, and VirF is involved in protein degradation within the host cell . The coordinated action of these proteins enables successful transfer of genetic material and proteins across kingdoms.

What expression systems and purification strategies are most effective for recombinant virB3?

For successful expression and purification of virB3, researchers have employed the following approaches:

Expression SystemTagPurification MethodConsiderations
E. coliN-terminal His-tagLikely immobilized metal affinity chromatographyMembrane protein requires detergents for solubilization

Expression of virB3 in E. coli has been successful with an N-terminal His-tag, as evidenced by commercially available recombinant protein . For optimal results, researchers should consider:

  • Using bacterial strains optimized for membrane protein expression (e.g., C41/C43)

  • Testing different induction conditions (temperature, IPTG concentration)

  • Employing appropriate detergents for membrane protein solubilization

  • Utilizing a step-wise purification approach that maintains protein stability

After purification, it's recommended to store the protein at -20°C/-80°C and avoid repeated freeze-thaw cycles to maintain functionality .

What fusion constructs have been developed for studying virB3 localization and function?

Several fusion constructs have been developed to investigate virB3 localization, topology, and function:

Fusion ConstructDescriptionApplicationReference
virB3-phoAFusions at codons 40, 49, 77, 85, or 108Membrane topology analysis
gfp-virB3N-terminal GFP fusionCellular localization studies
virB3-gfpC-terminal GFP fusionCellular localization studies

These constructs provide valuable tools for understanding virB3's orientation in the membrane and its subcellular localization. The PhoA fusions are particularly useful for topology studies because alkaline phosphatase is only active when located in the periplasmic space, allowing researchers to map which portions of virB3 are exposed to the periplasm versus the cytoplasm .

How can researchers analyze virB3's membrane topology and integration?

Analysis of virB3's membrane topology can be accomplished using several complementary approaches:

  • PhoA fusion analysis: By creating sequential truncations of virB3 fused to alkaline phosphatase (as described in search result ), researchers can determine which domains are exposed to the periplasm (high PhoA activity) versus cytoplasm (low activity).

  • GFP fusion microscopy: Both N-terminal and C-terminal GFP fusions enable visualization of virB3 localization within the bacterial cell, providing insight into its distribution and potential interaction with other T4SS components .

  • Protease accessibility assays: Treatment of spheroplasts or membrane vesicles with proteases can reveal which portions of the protein are accessible from different compartments.

  • Cysteine scanning mutagenesis: Introduction of cysteine residues throughout the protein, followed by reactivity assays with membrane-impermeable reagents, can map exposed regions.

These approaches collectively provide a comprehensive understanding of how virB3 is oriented within the bacterial membrane.

How does virB3 contribute to the assembly and function of the Type IV Secretion System?

VirB3 plays a crucial structural role in the assembly and function of the T4SS, though its precise mechanism remains under investigation. Evidence suggests that:

  • Its membrane localization positions it as a component of the channel complex that spans the bacterial inner membrane.

  • The protein likely interacts with other VirB components, particularly other membrane-associated proteins like VirB4, VirB8, and VirB10.

  • Its relatively small size (108 amino acids) suggests it may serve as an adaptor or connector within the larger secretion apparatus.

  • VirB3 may undergo conformational changes during T4SS assembly or substrate translocation.

Research using various virB3 mutants has demonstrated that the protein is essential for substrate transfer, as mutations in virB3 can disrupt the secretion process and impair virulence .

What are the structural determinants of virB3 that enable its function?

While the complete three-dimensional structure of virB3 has not been determined, sequence analysis and experimental evidence provide insights into its structural features:

  • Transmembrane domains: The amino acid sequence contains hydrophobic regions consistent with membrane-spanning segments.

  • Functional domains: Fusion studies with PhoA at different truncation points (residues 40, 49, 77, 85, and 108) suggest the protein has distinct regions with different topological orientations .

  • Protein-protein interaction motifs: VirB3 likely contains regions that mediate interactions with other T4SS components, though these have not been fully characterized.

Further structural studies using techniques such as X-ray crystallography or cryo-electron microscopy of the assembled T4SS complex would provide more detailed information about virB3's structure-function relationships.

How do mutations in virB3 affect T4SS assembly and function?

Mutational analysis of virB3 has revealed several insights about its functional importance:

  • Complete deletion of virB3 typically results in a non-functional T4SS, demonstrating its essential role in the secretion process.

  • Point mutations in key residues can affect assembly of the T4SS complex, substrate recognition, or channel function.

  • The terminal regions of virB3 appear tolerant of fusion partners (as evidenced by functional GFP fusions), suggesting these regions may be less critical for core function .

When designing virB3 mutants for functional studies, researchers should consider:

  • Conserved residues across bacterial species (more likely to be functionally important)

  • Predicted membrane-spanning regions (mutations here may affect membrane integration)

  • Potential interaction interfaces with other VirB proteins

How does virB3 compare functionally to other components of the T4SS?

Within the T4SS, different components serve distinct functions that collectively enable DNA and protein translocation:

ProteinPrimary FunctionLocalizationComparison to virB3
VirB3Structural component of secretion channelInner membraneFocus of this FAQ
VirE2ssDNA-binding protein, translocated effectorCytoplasm, translocatedEffector vs. structural role
VirFF-box protein, translocated effectorCytoplasm, translocatedEffector vs. structural role
VirE3Novel effector proteinCytoplasm, translocatedEffector vs. structural role
VirB1-VirB11Various structural/functional roles in T4SSVarious locationsTogether form secretion apparatus

Unlike effector proteins (VirE2, VirF, VirE3) that are themselves translocated into host cells, virB3 remains in the bacterial cell as part of the secretion machinery . This fundamental difference reflects their distinct roles in the infection process.

What unique features distinguish virB3 from similar proteins in other bacterial secretion systems?

VirB3 homologs are found in many T4SS across different bacterial species, with some distinguishing features:

  • Size and sequence conservation: VirB3 is relatively small (108 aa in A. tumefaciens) compared to other T4SS components.

  • Membrane topology: The specific arrangement of transmembrane domains may differ between VirB3 homologs.

  • Species-specific adaptations: While the core function appears conserved, specific sequence adaptations may reflect host-specific requirements.

Comparative genomic and structural analyses of VirB3 homologs across different bacteria could provide insights into the evolution and functional adaptation of T4SS components.

What challenges arise when working with recombinant virB3 and how can they be addressed?

As a membrane protein, virB3 presents several technical challenges:

ChallengeSolution Approaches
Poor expressionOptimize codon usage, use specialized expression strains, lower induction temperature
Inclusion body formationTest different solubilization conditions, fusion tags, or refolding protocols
Protein instabilityAdd stabilizing agents (glycerol, detergents), avoid freeze-thaw cycles
Functional assessmentDevelop complementation assays in virB3-deficient strains
Maintaining native structureUse mild detergents, consider membrane mimetics (nanodiscs, liposomes)

When working with virB3, researchers should consider adding 5-50% glycerol to storage buffers and avoiding repeated freeze-thaw cycles to maintain protein stability .

How can researchers verify the proper folding and functionality of purified virB3?

Verifying the proper folding and functionality of purified virB3 requires multiple approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Size-exclusion chromatography to evaluate oligomeric state

    • Thermal shift assays to assess protein stability

  • Functional validation:

    • Complementation of virB3-deficient Agrobacterium strains

    • In vitro reconstitution with other T4SS components

    • Protein-protein interaction assays with known VirB3 partners

  • Structural integrity:

    • Limited proteolysis to evaluate compact folding

    • Intrinsic fluorescence to assess tertiary structure

These complementary approaches provide confidence that purified virB3 maintains its native conformation and functional capabilities.

What are the current gaps in understanding virB3 function and structure?

Despite progress in characterizing virB3, several knowledge gaps remain:

  • High-resolution structural information is lacking, particularly in the context of the assembled T4SS complex.

  • The precise molecular interactions between virB3 and other T4SS components remain poorly defined.

  • The dynamic behavior of virB3 during substrate translocation is not well understood.

  • Species-specific adaptations of virB3 across different bacteria with T4SS have not been systematically compared.

Addressing these gaps would significantly advance our understanding of how virB3 contributes to T4SS function and bacterial pathogenesis.

How might understanding virB3 contribute to biotechnological applications?

Research on virB3 and the T4SS has several potential biotechnological applications:

  • Engineered delivery systems: Modified T4SS components, including virB3, could be engineered to deliver specific proteins or DNA to target cells for therapeutic purposes.

  • Antimicrobial development: As an essential component of virulence in several pathogens, virB3 could represent a target for novel antimicrobial compounds.

  • Synthetic biology tools: Better understanding of virB3's role in protein translocation could lead to new tools for protein delivery in various biological systems.

  • Agricultural applications: Engineering modified Agrobacterium strains with altered virB3 function could enhance plant transformation efficiency for crop improvement.

These applications highlight the translational potential of fundamental research on virB3 and related T4SS components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.