Recombinant Agrobacterium tumefaciens Protein virB6 (virB6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Type IV Secretion

VirB6 mediates critical interactions during T4SS assembly:

  • Complex Formation: Facilitates disulfide-linked VirB7 homodimers and VirB7-VirB9 heterodimers, essential for stabilizing the secretion channel and T-pilus biogenesis .

  • Substrate Translocation: Required for transferring IncQ plasmid and VirE2 effector proteins to host cells, even in the absence of detectable T pili .

  • Localization: Polar localization in A. tumefaciens depends on VirB7–VirB11 proteins; mislocalization disrupts DNA transfer .

Mutational Analysis

Insertion mutants (e.g., D60.i4, L191.i4) reveal VirB6’s dual role in secretion and pilus assembly:

VariantPhenotypeReference
Wild-Type VirB6Supports VirB7/VirB9 complex formation, T-pilus assembly, and substrate transfer
VirB6.i4Assembles novel VirB7/VirB9 complexes; enables substrate transfer without T pili
ΔC-terminalMislocalizes VirB6 and abolishes DNA transfer

Overexpression Effects

  • VirB6 Overproduction: Induces VirB9 aggregation and blocks substrate transfer at 28°C, but not at 20°C, suggesting temperature-dependent VirB protein stability .

  • VirB6 Depletion: Reduces VirB7 dimer accumulation, partially restored by plasmid complementation .

Interaction Network

VirB6 forms dynamic complexes with other T4SS components:

Interacting PartnersInteraction TypeFunctional Outcome
VirB7Disulfide-linked homodimer/heterodimer Stabilizes T-pilus and secretion channel
VirB9Co-immunoprecipitation Core complex assembly
VirB10Glutathione pulldown Stabilizes secretion apparatus

Applications in Research

Recombinant VirB6 is pivotal for:

  • Mechanistic Studies: Elucidating T4SS assembly and substrate translocation .

  • Protein Interaction Mapping: Identifying binding partners via co-immunoprecipitation .

  • Drug Development: Targeting bacterial conjugation systems in pathogenic species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will fulfill it based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
virB6; Atu6172; AGR_pTi_10; Protein VirB6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
virB6
Target Protein Sequence
MNFTIPAPFTAIHTIFDLAFTTSLDTMLGTIQEAVSAPLVACVTLWIIVQGILVMRGEID TRGGITRVITVTVVVALVVGQANYHDYVVSVFEETIPNFIQQFSGSGLPLQTIPAQLDTM FALTQAAFQRIASEIGPMNDQDILAFQGAQWVFYGTLWSAFGIYDAVGILTKVLLAIGPL ILTGYIFDRTRDIAAKWIGQLITYGLLLLLLNLVATIVILTEATALTLMLGVITLAGTTA AKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQSANSLYRRFAQVDRR
Uniprot No.

Target Background

Function
VirB proteins are believed to function at the bacterial surface, playing a crucial role in directing T-DNA transfer to plant cells.
Database Links

KEGG: atu:Atu6172

Protein Families
TrbL/VirB6 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and topology of VirB6 in Agrobacterium tumefaciens?

VirB6 is a polytopic inner membrane protein with multiple transmembrane segments (TMS). Computer algorithms have predicted five transmembrane segments, although some methods suggest additional TMS . The protein contains several important structural features:

  • A central region with a large periplasmic loop (P2) spanning residues 84-165

  • A multi-membrane-spanning region C-terminal to loop P2 (residues 165-245)

  • Two terminal regions (residues 1-64 and 245-290) that are critical for substrate transfer

  • A unique cysteine residue at position 42 that appears to be buried in a transmembrane segment

To determine VirB6 topology, researchers have employed several methodologies:

  • Fusing VirB6 N-terminal fragments to periplasmically active alkaline phosphatase (PhoA) or cytoplasmically-active β-galactosidase (β-Gal)

  • Using site-directed mutagenesis to introduce cysteine substitutions and testing their accessibility with membrane-impermeable reagents like MPB (3-(N-maleimidylpropionyl) biocytin)

  • Expressing VirB6-GFP fusion proteins to visualize cellular localization

How does VirB6 contribute to the assembly and function of the type IV secretion system?

VirB6 plays multiple crucial roles in T4SS assembly and function:

  • It mediates the formation of VirB7 and VirB9 complexes required for both T-pilus biogenesis and secretion channel formation

  • It stabilizes other VirB proteins, particularly VirB5 and VirB3, during biogenesis of the secretion machine

  • Its periplasmic loop (P2) forms part of the secretion channel and interacts with the exiting T-strand DNA

  • It functions as an interaction nexus, facilitating substrate transfer from VirB6 to VirB8 and subsequently to other VirB proteins (VirB2 and VirB9)

  • It localizes to the cell poles, which is critical for the proper assembly and function of the T4SS apparatus

Research has shown that a virB6 gene deletion mutant accumulates VirB7 dimers at diminished steady-state levels, while complementation with wild-type virB6 partially restores these levels .

What experimental approaches are used to study VirB6 localization in bacterial cells?

Researchers employ several techniques to study VirB6 localization:

  • Immunofluorescence microscopy: This technique has revealed that VirB6 localizes to cell poles in wild-type bacteria but distributes randomly on cell membranes in the absence of the tumor-inducing plasmid

  • Colocalization experiments: These have demonstrated that VirB6 and another DNA transfer protein, VirD4, localize to the same pole, indicating their proximity and suggesting VirB6 is a component of the transport apparatus

  • GFP fusion proteins: VirB6-GFP fusion proteins display fluorescence at the poles, in contrast to the uniform fluorescence of cells producing only GFP

  • Mutagenesis studies: Identifying regions essential for polar localization through targeted mutations, such as the conserved tryptophan at position 197 and the C-terminus

  • Immunoprecipitation: Used to identify protein-protein interactions that may influence localization

What protein-protein interactions does VirB6 form within the type IV secretion apparatus?

VirB6 engages in multiple protein-protein interactions essential for T4SS function:

  • VirB6-VirB7-VirB9 complex: This complex has been isolated by immunoprecipitation and glutathione S-transferase pulldown assays from detergent-solubilized membrane extracts

  • VirB7-VirB9-VirB10 complex: This complex was also identified in membrane extracts and appears to interact with VirB6

  • VirB6-VirB8 interactions: The multi-membrane-spanning region of VirB6 (residues 165-245) is required for substrate transfer from VirB6 to VirB8

  • Terminal regions interactions: The N-terminal (1-64) and C-terminal (245-290) regions of VirB6 are required for substrate transfer to the periplasmic and outer membrane-associated VirB2 and VirB9 subunits

  • Polar localization dependencies: VirB6 requires five other VirB proteins (VirB7-VirB11) for its polar localization, suggesting complex interdependencies

These interactions have been studied using various experimental approaches including GST pulldown assays, immunoprecipitation, and transfer DNA immunoprecipitation (TrIP) studies .

How do mutations in VirB6 affect T-pilus formation and substrate transfer?

Mutations in VirB6 have diverse effects on T-pilus formation and substrate transfer:

  • Overproduction effects: VirB6 overproduction correlates with formation of higher-order VirB9 complexes or aggregates and blocks substrate transfer without disrupting T-pilus production. This phenotype appears at 28°C (which favors VirB protein turnover) but not at 20°C

  • Insertion mutations (VirB6.i4): Several VirB6 proteins with 4-residue insertions assemble novel VirB7 and VirB9 complexes detectable by nonreducing SDS-PAGE

  • Specific insertion mutants: Two strains producing D60.i4 and L191.i4 mutant proteins can translocate IncQ plasmid and VirE2 effector protein substrates even in the absence of a detectable T pilus

  • Critical residues: Alteration of tryptophan 197 or deletion of the extreme C-terminus leads to mislocalization of VirB6 and abolishes DNA transfer function

These findings suggest that the relationship between T-pilus formation and substrate transfer is complex, and that different domains of VirB6 contribute distinctly to these functions.

What are the specific domains of VirB6 that mediate substrate translocation during type IV secretion?

TrIP (transfer DNA immunoprecipitation) studies have identified several VirB6 functional domains critical for substrate translocation:

  • Central periplasmic loop P2 (residues 84-165): This domain mediates the interaction of VirB6 with the exiting T-strand DNA, functioning as part of the secretion channel

  • Multi-membrane-spanning region (residues 165-245): Located C-terminal to loop P2, this region is required for substrate transfer from VirB6 to the bitopic membrane subunit VirB8

  • Terminal regions (residues 1-64 and 245-290): These areas are essential for substrate transfer to the periplasmic and outer membrane-associated VirB2 and VirB9 subunits

  • Tryptophan 197: This conserved residue is essential for polar localization and DNA transfer function

  • C-terminal domain: The extreme C-terminus is critical for proper localization and function; in silico analysis suggests it can form an amphipathic helix that may encode a protein-protein interaction domain essential for targeting VirB6 to the cell pole

The methodological approach of TrIP combined with targeted mutagenesis has been particularly valuable in mapping these functional domains, allowing researchers to track substrate passage through the secretion channel.

What methodologies are most effective for studying membrane topology of VirB6?

Several complementary approaches have proven effective for investigating VirB6 membrane topology:

  • Reporter protein fusion analysis:

    • PhoA (alkaline phosphatase) fusions for periplasmic domains

    • β-galactosidase fusions for cytoplasmic domains

    • These fusion proteins provide activity-based evidence for domain localization

  • Cysteine accessibility methods:

    • Site-directed mutagenesis to introduce cysteine residues at specific positions

    • Treatment with membrane-impermeable reagents like MPB (3-(N-maleimidylpropionyl) biocytin)

    • Pretreatment with AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid) to block surface-exposed cysteines

  • Computational prediction tools:

    • Multiple algorithms should be employed as consensus approaches

    • Five widely used methods predicted five transmembrane segments for VirB6, though some predicted additional segments

  • Fluorescent protein fusions:

    • GFP fusions to study localization patterns

    • Especially useful for tracking polar localization

These techniques are most powerful when used in combination, as each has limitations. For instance, reporter protein fusions can sometimes disrupt the natural membrane topology, particularly in N-terminal regions.

How can researchers effectively express and purify recombinant VirB6 for structural studies?

Expressing and purifying membrane proteins like VirB6 presents significant challenges. Based on approaches used in the research literature, an effective strategy would include:

  • Expression systems:

    • The pSJ6300 plasmid expressing GST-'VirB6 has been successfully used to produce the C-terminal portion of VirB6 in E. coli

    • IPTG-induced expression in E. coli has been effective for producing GST-fusion proteins for antibody production

  • Fusion protein approaches:

    • GST (Glutathione S-transferase) fusions enhance solubility and facilitate purification

    • His-tagged constructs allow for metal affinity chromatography

    • MBP (maltose-binding protein) fusions can improve membrane protein solubility

  • Membrane protein extraction:

    • Detergent solubilization is critical; detergent-solubilized membrane extracts have been used successfully in immunoprecipitation experiments

    • Gentle extraction conditions help maintain protein-protein interactions

  • Purification strategy:

    • For GST fusions: glutathione affinity chromatography

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Ion exchange chromatography for further purification

  • Verification methods:

    • Western blotting with anti-VirB6 antibodies

    • Mass spectrometry to confirm protein identity

The challenges of membrane protein purification often necessitate expressing smaller, soluble domains rather than the full-length protein for initial structural studies.

What is the mechanistic relationship between VirB6 expression levels and T4SS function?

The relationship between VirB6 expression levels and T4SS function is complex and temperature-dependent:

  • VirB6 deletion effects:

    • A virB6 gene deletion mutant accumulates VirB7 dimers at diminished steady-state levels

    • Complementation with wild-type virB6 partially restores dimer accumulation

  • Overexpression effects:

    • VirB6 overproduction correlates with formation of higher-order VirB9 complexes or aggregates

    • Overexpression blocks substrate transfer without disrupting T-pilus production

    • These phenotypes are observed at 28°C (which favors VirB protein turnover) but not at 20°C

  • Temperature-dependent regulation:

    • At 28°C, VirB protein turnover is favored, making the system more sensitive to stoichiometric imbalances

    • At 20°C, the system appears more robust to variations in VirB6 levels

  • Proposed mechanism:

    • VirB6 likely serves as a scaffolding protein that, at optimal levels, facilitates proper complex formation

    • Overexpression may sequester interaction partners or lead to non-functional aggregates

    • Underexpression fails to provide sufficient scaffolding for stable complex formation

This suggests that proper stoichiometry of T4SS components is critical for function, with VirB6 playing a central regulatory role in complex assembly.

How do VirB6 paralogs in different bacterial species compare in structure and function?

VirB6 paralogs show interesting variations across bacterial species, with Anaplasma phagocytophilum providing a well-studied example:

  • Paralog organization in A. phagocytophilum:

    • Four copies of virB6 in tandem (virB6-1 through virB6-4)

    • Arranged within an operon containing sodB, virB3, and virB4-1

    • virB6-4 contains an extensive repeat domain with variable numbers of repeats at the 3' end

  • Expression patterns:

    • All four VirB6 paralogs are expressed during infection of both human and tick cells

    • Transcription occurs as part of a polycistronic mRNA

  • Localization differences:

    • VirB6-3 and VirB6-4 appear to be located predominantly at the periphery of A. phagocytophilum as multiple foci or punctate structures

    • VirB6-4 may also associate with the parasitophorous vacuole in tick cells

  • Functional importance:

    • Disruption of virB6-4 has polar effects on the sodB-virB operon

    • Altered expression of genes within this operon is linked to attenuated growth in human and tick cells

  • Paralog sequences:

ParalogSequence Length (residues)Notable Features
VirB6-156Contains YVAARLGFAGRDPKEVLKESKYPRE motif
VirB6-258Rich in glycine; contains IPEYLHISGGIVKPSSMEKLDDEHE motif
VirB6-360Contains multiple glycine repeats; surface exposed
VirB6-470Contains repeat sequences; surface exposed; critical for growth

This diversity in VirB6 paralogs suggests specialized functions have evolved in different bacterial species while maintaining core T4SS functions.

What experimental approaches can differentiate between the roles of VirB6 in T-pilus formation versus secretion channel assembly?

Distinguishing between VirB6's roles in T-pilus formation and secretion channel assembly requires sophisticated experimental approaches:

  • Insertion mutant analysis:

    • Certain VirB6 insertion mutants (D60.i4 and L191.i4) can translocate substrates without detectable T-pilus formation

    • This uncoupling indicates separable functions that can be analyzed through targeted mutations

  • Domain-specific mutations:

    • Mutations in different domains produce distinct phenotypes

    • Central periplasmic loop P2 (residues 84-165) mutations specifically affect substrate interaction

    • Terminal regions (residues 1-64 and 245-290) mutations impact transfer to outer components

  • Transfer DNA immunoprecipitation (TrIP):

    • This technique tracks DNA substrate movement through the T4SS

    • Cross-linking the DNA substrate to channel components at different stages

    • Immunoprecipitation with antibodies against specific VirB proteins

    • Detection of the DNA substrate by PCR or other methods

  • Electron microscopy:

    • Visualization of T-pilus structures in wild-type versus mutant strains

    • Immunogold labeling to locate VirB6 within the assembled structures

  • VirB protein stability assays:

    • Monitoring levels of other VirB proteins in virB6 mutants

    • Western blot analysis to detect complex formation under different conditions

These approaches, particularly when combined, allow researchers to differentiate VirB6's dual roles in T-pilus formation and secretion channel assembly.

What are the challenges and solutions in generating antibodies against VirB6 for research applications?

Generating effective antibodies against membrane proteins like VirB6 presents several challenges:

  • Challenges:

    • Multiple transmembrane domains limit accessible epitopes

    • Low natural expression levels provide limited antigen

    • Conformational epitopes may be lost in denatured preparations

    • Detergent solubilization can mask important epitopes

  • Solutions employed in research:

    • Fusion protein approaches: GST-'VirB6 fusion proteins have been successfully used for antibody production

    • Peptide antibodies: Synthetic peptides corresponding to specific domains, particularly hydrophilic regions predicted to be surface-exposed

  • Epitope selection strategy:

    • For A. phagocytophilum VirB6 paralogs, specific peptides were designed:

    ParalogPeptide LengthStrategy
    VirB6-156 residuesN-terminal cysteine for conjugation + hydrophilic sequence
    VirB6-258 residuesN-terminal cysteine for conjugation + hydrophilic sequence
    VirB6-360 residuesN-terminal cysteine for conjugation + predicted surface loop
    VirB6-470 residuesC-terminal repeat region specific peptide
  • Validation approaches:

    • Immunofluorescence microscopy with infected and uninfected cells

    • Western blotting against wild-type and mutant proteins

    • Preimmune sera controls to confirm specificity

    • Colocalization with known T4SS components

  • Applications of validated antibodies:

    • Tracking protein expression during infection

    • Determining subcellular localization

    • Immunoprecipitation for protein-protein interaction studies

    • Transfer DNA immunoprecipitation (TrIP) studies

The success of antibody production significantly impacts the types of experiments that can be performed with VirB6 and other membrane components of the T4SS.

How can researchers quantitatively assess the impact of VirB6 mutations on substrate transfer efficiency?

Quantitative assessment of substrate transfer efficiency in VirB6 mutants requires precise methodologies:

  • Conjugation frequency assays:

    • Measure the frequency of plasmid transfer between bacterial cells

    • Calculate the ratio of transconjugants to donors

    • Compare wild-type to various VirB6 mutants under standardized conditions

  • Reporter systems:

    • Cre recombinase reporter assays: measure DNA transfer by detecting recombination events in recipient cells

    • GFP or luciferase reporters in recipient cells activated upon successful transfer

    • Quantitative measurements using flow cytometry or luminometry

  • PCR-based detection:

    • Quantitative PCR to measure transferred DNA in recipient cells

    • Standard curves for absolute quantification

    • Internal controls to normalize for cell number and extraction efficiency

  • Immunological detection of transferred effector proteins:

    • Western blot analysis with densitometry for semi-quantitative assessment

    • ELISA-based quantification of transferred proteins

    • Immunofluorescence with image analysis software for quantification

  • Time-course experiments:

    • Measure transfer kinetics in wild-type versus mutant strains

    • Determine rate constants for the transfer process

    • Identify rate-limiting steps affected by specific mutations

  • Competitive index assays:

    • Co-infect with wild-type and mutant strains

    • Measure relative abundance over time

    • Calculate competitive index to quantify fitness differences

These quantitative approaches provide more precise information about the functional consequences of VirB6 mutations than qualitative assays alone, allowing for detailed structure-function analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.