Recombinant Agrobacterium tumefaciens Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

ctaB (Uniprot ID: A9CJX3) belongs to the EC 2.5.1.- enzyme family and is also known as Heme B farnesyltransferase or Heme O synthase. Its primary function is to transfer a farnesyl group to protoheme IX, forming heme O, which is essential for bacterial terminal oxidases in the respiratory chain.

ParameterValue/Description
Gene NamectaB
Protein LengthFull-length (1–317 amino acids)
EC ClassificationEC 2.5.1.-
Alternative NamesHeme B farnesyltransferase; Heme O synthase
Key FunctionCatalyzes protoheme IX farnesylation to produce heme O

Implications for Agrobacterium-Plant Interactions

While not directly studied in A. tumefaciens, heme-dependent respiratory enzymes likely influence bacterial survival and transformation efficiency. For example:

  • Respiratory Fitness: Efficient respiration via ctaB-derived heme O may enhance bacterial competitiveness during plant colonization .

  • Hormone Regulation: Plant hormones like salicylic acid (SA) suppress vir gene expression in A. tumefaciens . ctaB activity could indirectly modulate bacterial responses to such hormones by maintaining redox balance.

Research Tools

  • Enzyme Kinetics: Recombinant ctaB is used to study heme modification mechanisms and substrate specificity.

  • Structural Biology: His-tagged ctaB facilitates crystallization for X-ray crystallography, aiding in understanding farnesyltransferase catalysis.

Genetic Engineering

  • Vector Development: While ctaB itself is not directly involved in A. tumefaciens’ Ti plasmid-mediated transformation, understanding its role in bacterial physiology could inform strain optimization for enhanced transformation efficiency .

Knowledge Gaps

  • Species-Specific Studies: Most research on ctaB focuses on S. aureus; A. tumefaciens-specific studies are scarce.

  • Functional Redundancy: Potential compensatory mechanisms in A. tumefaciens for heme O synthesis remain unexplored.

Future Research Priorities

  1. Knockout Studies: Assessing ctaB deletion effects on A. tumefaciens’ respiration, virulence, and transformation capacity.

  2. Gene Expression Profiling: Identifying downstream targets of ctaB in A. tumefaciens using RNA-seq.

  3. Biotechnological Optimization: Engineering ctaB for improved heme production in bacterial hosts.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing it during production.
Synonyms
ctaB; Atu0769; AGR_C_1402; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
ctaB
Target Protein Sequence
MTVIDDRDMMGAESSELSEAGARDYFELLKPRVMSLVVFTAFAGLVLAPGEINPILGLIA ILCIAVGAGASGALNMWYDADIDAVMTRTAKRPIPSGRIAPREALAFGLTLSAFSVVILG LAVNWFSAGLLAFTIFFYAVVYTMWLKRSTPQNIVIGGAAGAFPPMLGWACVTGGVSLDS VILFLIIFLWTPAHFWALALFKMRDYGAVGIPMMPNVAGERSTKNQMIVYAVLTAAAAVA PFFTGLASAGYGIFAAVLSAIFVYCSFDVRRMPEGDEKMLPAKKMFAYSVLYLFAIFSGL LADHFAPALKAVISGVL
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O by replacing the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links

KEGG: atu:Atu0769

STRING: 176299.Atu0769

Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX Farnesyltransferase (ctaB) and what is its role in Agrobacterium tumefaciens?

Protoheme IX farnesyltransferase (ctaB) in Agrobacterium tumefaciens is a membrane protein belonging to the UbiA prenyltransferase family. It catalyzes a critical reaction in the bacterial respiratory chain by converting heme B (protoheme IX) to heme O through the substitution of the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group . This enzyme plays an essential role in the synthesis of terminal oxidases that facilitate bacterial respiration.

The protein is encoded by the ctaB gene (also annotated as Atu0769 or AGR_C_1402 in strain C58) and typically consists of approximately 317 amino acids with multiple transmembrane domains characteristic of membrane-embedded enzymes . With a molecular mass of approximately 34.3 kDa, ctaB contributes significantly to A. tumefaciens energy metabolism and potentially its virulence mechanisms .

How can researchers express and purify recombinant ctaB protein for structural and functional studies?

Expression and purification of recombinant ctaB presents significant challenges due to its nature as an integral membrane protein. Based on established protocols, researchers should consider the following methodology:

Expression Systems Selection:

  • E. coli expression: Utilize specialized strains designed for membrane protein expression (C41/C43)

  • Yeast expression: Pichia pastoris offers advantages for eukaryotic processing

  • Baculovirus system: Insect cell expression provides better folding for complex proteins

  • Mammalian cell expression: For specific post-translational modifications

Optimized Expression Protocol:

  • Clone the ctaB coding sequence into a vector containing:

    • An inducible promoter (T7 or tac)

    • Appropriate fusion tags (His6, GST, or MBP)

    • Optional solubility-enhancing tags

  • Conduct small-scale expression trials varying:

    • Temperature (typically reduced to 16-20°C for membrane proteins)

    • Inducer concentration

    • Expression duration

Purification Strategy:

  • Isolate membrane fractions through ultracentrifugation

  • Solubilize membrane proteins using appropriate detergents:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl glucoside (OG)

    • Digitonin for gentler extraction

  • Perform affinity chromatography (Ni-NTA for His-tagged protein)

  • Further purify via size exclusion chromatography

  • Verify purity using SDS-PAGE (targeting ≥85% purity)

For optimal results, researchers should evaluate multiple expression and purification conditions specifically optimized for A. tumefaciens ctaB.

What experimental approaches are most effective for studying ctaB function in A. tumefaciens?

Several complementary experimental approaches can be employed to comprehensively study ctaB function:

Genetic Manipulation Approaches:

  • Gene knockout strategies:

    • Create a ctaB deletion mutant via homologous recombination

    • Implement CRISPR-Cas9 for precise genome editing

    • Perform complementation studies to confirm phenotypes

  • Conditional expression systems:

    • Develop strains with inducible promoters controlling ctaB expression

    • Create temperature-sensitive alleles for functional studies

Biochemical Characterization:

  • Enzyme activity assays:

    • Measure conversion of heme B to heme O in vitro

    • Assess substrate specificity using purified recombinant enzyme

    • Screen potential inhibitors

  • Physiological assessment:

    • Analyze growth curves under varying oxygen concentrations

    • Measure oxygen consumption rates

    • Quantify ATP production

Omics Approaches:

  • Transcriptomics: Compare wild-type and ctaB mutant gene expression via RNA-seq

  • Proteomics: Identify protein expression changes resulting from ctaB deletion

  • Metabolomics: Map metabolic alterations in ctaB mutants

Plant-Pathogen Interaction Studies:

  • Evaluate virulence in plant models using wild-type and ctaB mutant strains

  • Assess tumor formation efficiency and development

  • Conduct bacterial competition assays in planta

Similar studies in Staphylococcus aureus demonstrated that deletion of ctaB attenuated growth and virulence while enhancing pigment production and antibiotic tolerance, suggesting important physiological roles that may have parallels in A. tumefaciens .

How does ctaB contribute to bacterial persistence and antibiotic tolerance?

Research suggests that ctaB plays a significant role in bacterial persistence and antibiotic tolerance, particularly toward quinolone antibiotics:

Experimental Evidence:
Studies with S. aureus ctaB deletion mutants demonstrated:

  • Enhanced formation of quinolone-tolerant persister cells in stationary phase

  • Specifically increased tolerance to ciprofloxacin and levofloxacin

  • No significant difference in persister formation for other antibiotics (vancomycin, rifampicin, streptomycin, tobramycin, gentamycin)

  • The persister phenotype was growth phase-dependent, manifesting predominantly in stationary phase

Time-Dependent Killing Dynamics:
In persister assays with 100× MIC ciprofloxacin or levofloxacin, the surviving ratios of ctaB mutants and wild-type strains were similar during the first 3 days of treatment but diverged significantly on days 4 and 5, with ctaB mutants showing markedly higher survival rates. Complementation with a functional ctaB gene partially reversed this phenotype .

Proposed Mechanisms:

  • Metabolic slowdown: Impaired respiratory chain function may reduce metabolic activity, a state associated with antibiotic tolerance

  • Energy limitation: Altered ATP levels may affect antibiotic target activity

  • Stress response activation: Respiratory deficiency may trigger protective stress responses

  • Altered membrane potential: Changes in membrane energetics could influence antibiotic uptake

These findings suggest that ctaB-dependent respiratory function influences bacterial susceptibility to certain antibiotics, particularly in stationary phase when bacteria naturally reduce their metabolic activity.

What comparative genomic analyses have been done on ctaB across different bacterial species?

Comparative genomic analyses reveal that ctaB belongs to the UbiA prenyltransferase family and is widely conserved across bacterial species:

Structural and Functional Conservation:
ctaB proteins across different bacterial species, including A. tumefaciens, Bartonella tribocorum, Staphylococcus aureus, and various other bacteria share:

  • Common functional domains characteristic of prenyltransferases

  • Conserved amino acid sequences involved in substrate binding

  • Similar predicted transmembrane topologies

  • Consistent enzymatic function in heme O biosynthesis

Species Variations:
The amino acid sequence of ctaB shows variations across bacterial species, as demonstrated in the following partial sequence comparison:

SpeciesLengthKey Sequence Features
A. tumefaciens317 aaMTVIDDRDMMGAESSELSEAGARDY...
B. tribocorum311 aaMSVSGELSVANGKSTPPKSSISDY...
S. aureusVariableContains similar functional domains

These sequence variations may reflect adaptations to specific ecological niches and metabolic requirements across bacterial species.

Evolutionary Implications:
The conservation of ctaB across diverse bacterial phyla suggests that:

  • Heme O biosynthesis represents an ancient and fundamental metabolic pathway

  • The basic enzymatic mechanism has been preserved despite sequence divergence

  • Species-specific variations likely reflect adaptations to particular environmental conditions

This conservation makes ctaB an interesting target for both fundamental research on bacterial metabolism and potential development of broad-spectrum antimicrobial strategies.

How are ctaB expression and activity regulated in bacteria?

The regulation of ctaB expression and activity involves multiple mechanisms that coordinate heme biosynthesis with cellular needs:

Transcriptional Regulation:
In Agrobacterium tumefaciens, the regulation of respiration-related genes, including ctaB, appears to be linked to growth phase and environmental conditions. While specific ctaB regulators in A. tumefaciens are not fully characterized in the provided search results, studies in other bacteria provide insight into potential regulatory mechanisms:

  • Growth phase-dependent regulation: Expression may vary between exponential and stationary phases

  • Oxygen-responsive regulation: Oxygen availability likely influences expression levels

  • Nutrient-dependent regulation: Carbon source and nutrient availability may modulate expression

Indirect Regulation via Metabolic Pathways:
In A. tumefaciens, the AttJ-AttM regulatory system has been shown to control quorum sensing signal turnover in a growth phase-dependent manner . While not directly linked to ctaB in the search results, such regulatory systems represent examples of how A. tumefaciens coordinates gene expression with growth phase and population density.

Post-translational Regulation:
Activity of membrane proteins like ctaB may be regulated by:

  • Substrate availability: Levels of heme B and farnesyl pyrophosphate

  • Membrane composition: Lipid environment affecting protein conformation

  • Protein-protein interactions: Potential assembly into respiratory complexes

The precise regulatory mechanisms controlling ctaB in A. tumefaciens represent an important area for future research, particularly in understanding how respiratory chain biosynthesis is coordinated with other cellular processes during plant infection and colonization.

What methodologies are available for studying protein-protein interactions involving ctaB?

Understanding protein-protein interactions (PPIs) involving membrane proteins like ctaB requires specialized methodologies:

In vivo Interaction Methodologies:

  • Bacterial two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid)

    • Split-ubiquitin systems adapted for membrane proteins

    • Methodology: Fuse ctaB to one domain of a split reporter protein and potential interactors to the complementary domain; interaction brings domains together to restore activity

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against ctaB or epitope tags

    • Critical considerations: Detergent selection for membrane protein solubilization without disrupting interactions

    • Methodology: Solubilize membranes, immunoprecipitate ctaB complexes, identify co-precipitated proteins by Western blotting or mass spectrometry

  • Proximity-dependent labeling:

    • BioID: Fusion of ctaB with a promiscuous biotin ligase

    • APEX2: Fusion with an engineered peroxidase

    • Methodology: Express fusion protein in bacteria, activate labeling, isolate biotinylated or otherwise tagged proteins, identify by mass spectrometry

In vitro Interaction Studies:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified ctaB in supported lipid bilayers or nanodiscs

    • Flow potential interaction partners across surface

    • Methodology: Detect binding through changes in refractive index; determine kinetic parameters

  • Microscale Thermophoresis (MST):

    • Label purified ctaB with fluorescent dye

    • Mix with varying concentrations of potential binding partners

    • Methodology: Measure changes in thermophoretic mobility upon binding

  • Native Mass Spectrometry:

    • Purify ctaB complexes in appropriate detergents

    • Transition to mass spectrometry-compatible conditions

    • Methodology: Analyze intact complexes to determine composition and stoichiometry

These methodologies must be optimized for membrane proteins like ctaB, with particular attention to maintaining the native lipid environment or using appropriate membrane mimetics to preserve physiologically relevant interactions.

How can knowledge about ctaB be applied to develop strategies for controlling A. tumefaciens infections?

Knowledge of ctaB function can inform novel strategies for controlling A. tumefaciens infections and preventing crown gall disease:

Targeted Inhibitor Development:

  • Design specific ctaB inhibitors:

    • Structure-based design targeting the enzyme's active site

    • Identification of compounds that block binding of farnesyl pyrophosphate or heme B

    • Development of peptidomimetics that disrupt protein function

  • Respiratory chain targeting:

    • Design compounds that interfere with terminal oxidase assembly

    • Develop molecules that uncouple respiratory function

Indirect Targeting Strategies:
Research has demonstrated that targeting related metabolic pathways can effectively control A. tumefaciens:

StrategyMechanismEffectiveness
Tannic acid applicationAffects iron assimilationReduced tumorigenesis and impaired establishment on tomato roots
Pseudomonas protegens biocontrolCompetes for ironReduced A. tumefaciens colonization

Implementation Approaches:

  • Preventive treatments:

    • Pre-planting soil treatments

    • Protective sprays during vulnerable growth stages

    • Seed treatments with biocontrol agents

  • Integrated management:

    • Combine ctaB-targeting compounds with existing control strategies

    • Rotate different approaches to prevent resistance development

  • Genetic approaches:

    • Engineer non-pathogenic competitive Agrobacterium strains with enhanced respiration

    • Develop plant varieties with improved resistance against respiratory-compromised bacteria

These strategies could provide eco-friendly alternatives to traditional chemical controls while specifically targeting the pathogen's fundamental metabolic processes.

What role does ctaB play in the adaptation of A. tumefaciens to different environmental conditions?

The membrane protein ctaB likely plays a crucial role in A. tumefaciens adaptation to varying environmental conditions encountered during its lifecycle:

Oxygen Adaptation:
As a component of the respiratory chain biosynthesis pathway, ctaB contributes to the bacterium's ability to adapt to different oxygen concentrations. A. tumefaciens encounters varying oxygen levels during:

  • Soil habitation (micro-aerobic to aerobic)

  • Root colonization (potentially oxygen-limited)

  • Plant tumor formation and colonization (variable oxygen tension)

The ability to maintain efficient respiration across these conditions provides a competitive advantage and supports pathogen survival.

Metabolic Flexibility:
By enabling efficient terminal oxidase production, ctaB contributes to A. tumefaciens' metabolic flexibility. This is particularly important considering:

  • Variable carbon sources available in different plant tissues

  • Different energy demands during various infection stages

  • Competition with other microorganisms in the rhizosphere

Stress Response Coordination:
Studies in other bacterial systems suggest respiratory chain components may coordinate with stress response systems. In S. aureus, ctaB deletion altered expression of multiple two-component regulatory systems , suggesting similar coordination may occur in A. tumefaciens.

Environmental Sensing:
The respiratory chain can function as an environmental sensing system, with electron flow and proton motive force serving as indicators of environmental conditions. ctaB's role in terminal oxidase biosynthesis may therefore contribute to the bacterium's ability to sense and respond to environmental changes.

Understanding ctaB's role in environmental adaptation provides insights into how A. tumefaciens successfully colonizes diverse plant hosts and persists in agricultural environments.

What are the implications of ctaB function for A. tumefaciens-mediated plant transformation systems?

ctaB function has significant implications for A. tumefaciens-mediated plant transformation systems, which are widely used in plant biotechnology:

Transformation Efficiency Considerations:
The respiratory function supported by ctaB likely influences:

  • Bacterial vigor: Energy production for the complex machinery of T-DNA transfer

  • Survival on plant tissues: Persistence during co-cultivation procedures

  • Stress resistance: Ability to withstand agricultural conditions

Optimization Strategies for Transformation Protocols:
Understanding ctaB and respiratory chain function can inform improvements to transformation methods:

  • Growth condition optimization:

    • Culturing bacteria under conditions that optimize respiratory chain composition

    • Adjusting oxygen levels during bacterial growth and plant co-cultivation

  • Media composition considerations:

    • Carbon source selection to support optimal respiratory function

    • Supplementation strategies to enhance bacterial fitness during transformation

Engineering Improved Transformation Strains:
Knowledge of ctaB function could guide genetic modifications:

  • Fine-tuning respiratory chain composition for enhanced performance

  • Optimizing energy production for T-DNA transfer without enhancing virulence

  • Improving bacterial survival during extended co-cultivation periods

Application in Different Plant Systems:
A. tumefaciens-mediated transformation is used across diverse plant species with protocols including:

  • Epicotyl transformation (demonstrated as effective in multiple plant species)

  • Root tissue transformation

  • Callus-based transformation systems

Enhanced understanding of ctaB's role in bacterial physiology could help tailor transformation protocols for specific plant systems, potentially improving transformation efficiency in recalcitrant species.

These considerations are particularly relevant for developing more efficient and reliable plant transformation systems for both research and commercial applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.