Recombinant Agrobacterium tumefaciens sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Phosphate Acquisition and Metabolic Integration

  • Phosphate Utilization: Sn-glycerol-3-phosphate transported via Ugp is primarily used as a phosphate source, not a carbon source .

  • Regulation:

    • Induced under phosphate starvation or in pho constitutive mutants .

    • Inhibited by glucose or α-methylglucoside due to inducer exclusion .

Functional Redundancy and Hybrid Transporters

  • UgpC–MalK Exchange: UgpC (ATPase) can be replaced by MalK (from maltose transport system) in hybrid transporters, restoring function in malK mutants .

  • Substrate Specificity: The permease (UgpA/E) does not directly determine substrate specificity, which is governed by the periplasmic binding protein .

Experimental Observations

ParameterObservationSource
Growth on sn-glycerol-3-phosphateInhibited as sole carbon source; requires alternate carbon source (e.g., glycerol)
Membrane SensitivityTransport activity lost in membrane vesicles or under osmotic shock
Toxic Analog ResistanceSelection for resistance to 3,4-dihydroxybutyl-1-phosphonate identifies binding protein mutants

Recombinant ugpA Products

Host SystemPurityKey FeaturesSource
E. coli≥85% (SDS-PAGE)Full-length (1–293 aa), N-terminal His tag
Cell-Free Expression≥85%Partial or full-length versions; suitable for biochemical assays

Applications in Research

  1. Biochemical Studies:

    • Analysis of ABC transporter assembly and substrate translocation .

    • Investigation of phosphate acquisition mechanisms in Agrobacterium .

  2. Biotechnology:

    • Potential use in engineering bacterial strains for enhanced phosphate uptake .

    • Reference protein for studying membrane protein folding and stability .

Comparative Analysis with Homologs

The ugpA system shares functional homology with other ABC transporters, such as the maltose (Mal) system in E. coli. Key differences include:

FeatureUgp System (A. tumefaciens)Mal System (E. coli)
SubstrateSn-glycerol-3-phosphateMaltose, maltodextrins
ATPaseUgpCMalK
RegulationPhosphate starvationMaltose/maltodextrin presence
Functional ExchangeUgpC ↔ MalK possible Limited cross-complementation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ugpA; Atu3186; AGR_L_3247; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
ugpA
Target Protein Sequence
MQSVVFPNKILPYLLVAPQIILTVIFFFWPASQALYQSTMREDAFGLSSNFVGLANFSAV LSDESYLNSLKVTVIFSVLTALVSMGLALLLATAADRVVRGKGFYRTMMIMPYAVAPAVA GMLWLFMFNPAMGTLSYILRRNGIMWDPLLDGNQAMLLVVAAAAWKQISYNFLFFVAGLQ AIPKSLLEAASIDGARGSRRFWTIVFPLLAPTTFFLLVVNTVYAFFDTFGIIHAVTGGGP AKATETLVYKVYNDGFVNLNLGSSAAQSVILMVIVIALTAFQFRFVEKRVHYG
Uniprot No.

Target Background

Function
This protein, ugpA, is a component of the ABC transporter complex UgpABCE in *Agrobacterium tumefaciens*. It is involved in the import of sn-glycerol-3-phosphate and is likely responsible for substrate translocation across the membrane.
Database Links

KEGG: atu:Atu3186

STRING: 176299.Atu3186

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of the ugpA protein in Agrobacterium tumefaciens?

ugpA (sn-glycerol-3-phosphate transport system permease protein) is a transmembrane protein consisting of 293 amino acids that functions as part of a binding protein-dependent transport system for sn-glycerol-3-phosphate in Agrobacterium tumefaciens. The protein contains multiple transmembrane domains that form a channel through which sn-glycerol-3-phosphate can be transported across the bacterial membrane. The full amino acid sequence reveals a hydrophobic protein with several membrane-spanning regions consistent with its role as a membrane permease .

The ugpA protein works in conjunction with other components of the transport system, including a periplasmic binding protein that initially captures sn-glycerol-3-phosphate in the periplasmic space. This binding protein is necessary but not sufficient for transport activity, indicating that ugpA plays an essential role in the translocation process across the membrane .

When examining the structural features, researchers should note that ugpA contains specific motifs characteristic of ABC transporter permeases, which facilitate the passage of substrates across the membrane in an energy-dependent manner.

How is ugpA expression regulated in Agrobacterium tumefaciens?

Expression of ugpA in Agrobacterium tumefaciens is primarily regulated by phosphate availability. The ugp-dependent transport system is induced under conditions of phosphate starvation and in mutants that are constitutive for the pho regulon . This regulatory mechanism ensures that the bacterium efficiently allocates resources for phosphate acquisition when environmental phosphate is limited.

The regulation likely involves transcriptional control mechanisms similar to those observed in other bacteria, where specific transcription factors respond to phosphate limitation by binding to promoter regions of genes involved in phosphate acquisition, including the ugp operon. Researchers investigating ugpA regulation should consider the following experimental approaches:

  • Quantitative PCR to measure ugpA transcript levels under varying phosphate concentrations

  • Reporter gene assays using the ugpA promoter to monitor expression patterns

  • Chromatin immunoprecipitation to identify transcription factors binding to the ugpA promoter region

  • Creation of deletion mutants in suspected regulatory genes to assess their impact on ugpA expression

It's worth noting that the regulatory mechanisms may interact with other signaling pathways in A. tumefaciens, particularly those involved in virulence and plant interaction, though the exact relationship remains an area requiring further research.

What is the relationship between ugpA function and bacterial metabolism?

The ugpA protein's role in sn-glycerol-3-phosphate transport connects it to both phosphate acquisition and carbon metabolism in A. tumefaciens. Interestingly, while the transport system efficiently imports sn-glycerol-3-phosphate, experimental evidence indicates that bacteria cannot use this compound as a sole carbon source, even when the transport system is highly active .

For researchers studying bacterial metabolism, this presents an interesting case of specialized nutrient acquisition systems that may have evolved primarily for phosphate scavenging rather than carbon acquisition, highlighting the priority of phosphate acquisition in bacterial survival strategies.

What expression systems are optimal for producing recombinant ugpA protein?

The optimal expression system for recombinant ugpA production is E. coli with an N-terminal His tag, as demonstrated in successful protein production protocols . When designing expression systems for ugpA, researchers should consider several factors:

  • Expression vector selection: Vectors with strong, inducible promoters like T7 or tac are recommended for membrane proteins

  • Fusion tag placement: The N-terminal His tag has been successfully implemented, allowing for efficient purification while maintaining protein function

  • Host strain selection: E. coli strains optimized for membrane protein expression (C41, C43, or Lemo21) may improve yields

  • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the folding of membrane proteins

  • Extraction buffers: Detergent screening is essential for optimal solubilization while maintaining protein structure

A typical expression protocol would involve transformation of the expression construct into the selected E. coli strain, culture growth to appropriate density, induction under optimized conditions, and harvesting of cells for protein extraction. The recombinant protein can then be purified using affinity chromatography targeting the His tag.

What purification methods yield the highest quality recombinant ugpA protein?

Purification of recombinant ugpA requires specialized approaches due to its nature as a membrane protein. Based on successful protocols, a multi-step purification strategy is recommended:

Table 1: Recommended Purification Protocol for Recombinant ugpA

StepMethodConditionsPurpose
1Cell lysisMechanical disruption or sonication in buffer with protease inhibitorsRelease of membrane proteins
2Membrane isolationUltracentrifugation (100,000 × g)Separation of membrane fraction
3SolubilizationDetergent screening (e.g., DDM, LDAO, C12E8)Extraction from membrane
4IMACNi-NTA affinity chromatography using His tagPrimary purification
5Size exclusionSuperdex 200 or similarRemoval of aggregates
6Quality controlSDS-PAGE, Western blot, mass spectrometryVerification of purity

The purified protein should be maintained in a stabilizing buffer containing an appropriate detergent above its critical micelle concentration to prevent aggregation. For long-term storage, lyophilization with 6% trehalose in Tris/PBS-based buffer at pH 8.0 has been shown to maintain protein stability .

Quality assessment through SDS-PAGE should confirm purity greater than 90%, and activity assays should be performed to verify functional integrity of the purified protein .

How can researchers verify the functionality of recombinant ugpA protein?

Verifying the functionality of recombinant ugpA presents unique challenges due to its role as part of a multi-component transport system. Several complementary approaches can be employed:

  • Reconstitution into liposomes: Incorporate purified ugpA into artificial membrane vesicles along with other components of the transport system to measure sn-glycerol-3-phosphate uptake

  • Complementation studies: Express recombinant ugpA in ugpA-deficient mutants and assess restoration of transport function

  • Binding assays: If direct substrate binding occurs, isothermal titration calorimetry or surface plasmon resonance with immobilized ugpA can detect interactions with sn-glycerol-3-phosphate

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm proper secondary structure formation, particularly the expected alpha-helical content typical of membrane transporters

  • In vitro transport assays: Using reconstituted proteoliposomes containing the complete transport system to measure sn-glycerol-3-phosphate uptake against a concentration gradient

It's important to note that the functional verification should account for the requirement of additional components, as evidence indicates that the periplasmic binding protein is necessary but not sufficient for transport activity . Therefore, a functional reconstitution may require multiple proteins from the transport system.

How does ugpA function relate to A. tumefaciens' ability to transform plant cells?

While there is no direct evidence linking ugpA specifically to plant transformation efficiency, the protein's role in phosphate acquisition may indirectly influence virulence and transformation capability. A. tumefaciens is renowned for its ability to transfer DNA segments from its Ti plasmid to plant cells, a process that requires multiple steps including bacterial attachment to plant surfaces, activation of virulence genes, generation and transport of the T-complex, and integration of T-DNA into the plant chromosome .

The expression of virulence genes in A. tumefaciens is regulated by various environmental signals, including phosphate availability. Since ugpA expression is induced under phosphate starvation conditions , and phosphate limitation can affect bacterial metabolism and gene expression broadly, there may be interplay between phosphate acquisition systems (including ugpA) and virulence mechanisms.

Researchers investigating this relationship should consider:

  • Creating ugpA knockout mutants and assessing their transformation efficiency

  • Examining virulence gene expression under conditions that modulate ugpA expression

  • Investigating the phosphate status of plant wound sites where A. tumefaciens typically initiates infection

  • Determining whether phosphate acquisition through the ugp system affects bacterial attachment to plant surfaces

What is the relationship between bacterial attachment to plant surfaces and transport systems like ugpA?

A. tumefaciens is an excellent colonizer of root surfaces and binds to the surfaces of plants and fungi . The attachment process involves multiple steps and bacterial factors, including exopolysaccharides, cellulose, and specific binding proteins. While direct evidence linking ugpA to attachment is lacking in the provided search results, insights into potential connections can be derived from related research.

The binding of A. tumefaciens to plant surfaces involves both reversible and irreversible phases. The initial reversible binding can be disrupted by washing, while irreversible binding involves the production of cellulose fibrils that anchor the bacteria to the plant surface . The synthesis of these attachment factors requires energy and resources, potentially connecting nutrient acquisition systems (like ugpA) to the attachment process.

Researchers have shown that regulation of attachment factors involves signaling molecules like cyclic-di-GMP (c-di-GMP), which integrates the synthesis of cellulose and unipolar polysaccharide (UPP) . Overexpression of genes encoding diguanylate cyclases (Atu1297 or Atu1060) increases cellulose synthesis but reduces virulence, highlighting the complex regulatory networks controlling attachment and virulence .

Future research could explore:

  • Whether phosphate limitation affects the expression of attachment factors

  • If ugpA mutants show altered attachment behaviors or colonization patterns

  • The potential co-regulation of nutrient acquisition and attachment mechanisms

  • How the availability of sn-glycerol-3-phosphate in the rhizosphere might influence root colonization

How can researchers address poor expression yields of recombinant ugpA?

Poor expression yields are a common challenge when working with membrane proteins like ugpA. Researchers can implement several strategies to improve expression:

Table 2: Troubleshooting Strategies for Improving ugpA Expression Yields

IssuePotential SolutionImplementation Details
Toxicity to host cellsUse tight promoter controlImplement systems with minimal leaky expression; consider using Lemo21(DE3) strain with tunable expression
Protein misfoldingLower expression temperatureReduce to 16°C after induction to slow folding process
Codon biasCodon optimizationAdapt the ugpA sequence to match codon usage preference of expression host
Inclusion body formationFusion partnersConsider adding solubility-enhancing tags (MBP, SUMO, thioredoxin)
Membrane capacity limitationMembrane proliferation inducersAdd phospholipid precursors or consider C41/C43 strains that allow membrane proliferation
DegradationProtease inhibitorsInclude a comprehensive protease inhibitor cocktail during extraction
Poor solubilizationDetergent screeningSystematically test different detergents for optimal extraction

Additionally, researchers might consider cell-free expression systems, which can sometimes yield better results for difficult membrane proteins by eliminating cellular toxicity concerns and allowing direct incorporation into provided membrane mimetics.

What strategies help overcome difficulties in purifying membrane proteins like ugpA?

Purification of membrane proteins presents unique challenges. The following strategies can help overcome common difficulties:

  • Optimized solubilization: Screen multiple detergents at various concentrations to identify conditions that efficiently extract ugpA from membranes while maintaining its native conformation. Mild detergents like DDM, LMNG, or GDN often provide a good balance between solubilization efficiency and protein stability.

  • Buffer optimization: Include stabilizing agents such as glycerol (10-20%), specific lipids that may be required for function, and appropriate salt concentrations to maintain protein stability.

  • Affinity tag placement: If N-terminal tagging proves problematic, consider C-terminal tags or internal tags placed in predicted loop regions that don't disrupt protein folding.

  • Scale-up considerations: Membrane protein purification often requires larger culture volumes to compensate for lower expression levels. Consider implementing bioreactor cultivation for improved biomass production.

  • Alternative chromatography methods: While IMAC is the primary method for His-tagged proteins, additional purification steps such as ion exchange or hydrophobic interaction chromatography may improve purity.

  • Stability during concentration: Use centrifugal concentrators with appropriate molecular weight cutoffs and add stabilizing agents to prevent aggregation during concentration steps.

  • Assessing protein quality: Implement multiple quality control methods including size-exclusion chromatography profiles, dynamic light scattering, and thermal stability assays to ensure the purified protein is monodisperse and properly folded.

How might structural studies of ugpA inform the design of improved plant transformation vectors?

Structural characterization of ugpA could provide valuable insights for enhancing A. tumefaciens-mediated plant transformation. While no direct structural data for ugpA is available in the provided search results, future research directions could include:

  • Cryo-EM or X-ray crystallography studies: Determining the three-dimensional structure of ugpA alone and in complex with other transport system components would reveal functional domains and interaction interfaces.

  • Structure-guided mutagenesis: Based on structural data, researchers could create targeted mutations to enhance protein stability or function, potentially improving bacterial fitness during the transformation process.

  • Comparative structural analysis: Comparing ugpA structures across different Agrobacterium strains with varying transformation efficiencies might identify structural features associated with enhanced virulence.

  • In silico molecular dynamics: Simulating ugpA behavior in membranes could reveal conformational changes during transport cycles and identify potential regulatory sites.

The insights gained from such studies could inform the engineering of A. tumefaciens strains with optimized nutrient acquisition systems, potentially enhancing their survival and function during the plant transformation process. This aligns with the broader synthetic biology approach to tailoring A. tumefaciens strains for specific plant transformation applications .

What potential exists for engineering ugpA to enhance A. tumefaciens as a tool for synthetic biology?

A. tumefaciens is increasingly recognized as a bacterium primed for synthetic biology applications, particularly in plant biotechnology . Engineering ugpA and related transport systems could contribute to this potential in several ways:

  • Metabolic engineering: Modifying ugpA to enhance phosphate acquisition could improve bacterial fitness during plant transformation, particularly in phosphate-limited environments.

  • Sensor development: Engineering ugpA-based biosensors for detecting phosphate levels in plant tissues could provide valuable feedback mechanisms for synthetic circuits in A. tumefaciens.

  • Expanding substrate range: Protein engineering approaches could potentially modify ugpA to transport alternative phosphate-containing compounds, expanding the metabolic capabilities of engineered strains.

  • Integration with virulence control: Developing synthetic regulatory circuits that coordinate phosphate acquisition through ugpA with virulence gene expression could create strains with environmentally responsive transformation capabilities.

  • Orthogonal transport systems: Engineering orthogonal variants of the transport system could enable selective nutrient acquisition in complex environments like the rhizosphere.

These approaches align with the broader vision of applying synthetic biology principles to A. tumefaciens, enabling "precision genetic control to generate high-quality transformation events in a wider range of host plants" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.