Recombinant Agrobacterium tumefaciens Uncharacterized protein Atu2659.1 (Atu2659.1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Atu2659.1 is produced via recombinant expression in E. coli, leveraging bacterial systems for cost-effective protein synthesis. Post-expression, purification involves affinity chromatography (His-tag) and lyophilization.

ParameterSpecification
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 50% glycerol recommended for long-term storage
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Research Applications

While Atu2659.1 remains uncharacterized in terms of function, its recombinant form is utilized in:

  • Structural Studies: High-purity protein (>90%) enables crystallography or NMR analysis .

  • Antigen Development: Serves as a target in ELISA assays (e.g., CUSABIO’s ELISA kit) .

  • Genomic Exploration: Part of broader studies on A. tumefaciens proteomes, particularly in understanding bacterial interactions with host plants .

Challenges and Future Directions

  • Functional Elucidation: Requires biochemical assays (e.g., enzyme activity tests, protein interaction studies).

  • Host-Pathogen Dynamics: Potential role in A. tumefaciens’ ability to transfer genetic material to plants, though not directly linked to T-DNA transfer mechanisms .

  • Industrial Applications: Could serve as a scaffold for biotechnological innovations, pending functional characterization.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Atu2659.1; AGR_C_4820; Uncharacterized protein Atu2659.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
Atu2659.1
Target Protein Sequence
MSCNQDTEILMLALFQTIDLALNLYTWVLIASAIFSWLYAFNVINSRNQFVNAIGSFLVN VTEPALRPIRRILPNLGGIDISPIILLLIIFFIRSFMWNTLYPMTV
Uniprot No.

Target Background

Protein Families
YggT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Atu2659.1 and what organism does it come from?

Atu2659.1 is an uncharacterized protein from Agrobacterium tumefaciens (also known as Agrobacterium fabrum), a rod-shaped soil bacterium renowned for its unique ability to transfer tumor-inducing plasmid (Ti plasmid) segments to plant cells. The protein consists of 106 amino acids and has not yet been fully characterized in terms of structure and function . A. tumefaciens is particularly notable in molecular biology for its capacity to genetically transform plants, making it an essential tool in plant genetic engineering and biotechnology applications .

What expression systems are available for producing recombinant Atu2659.1?

Recombinant Atu2659.1 is primarily produced using E. coli as the expression host. The full-length protein (amino acids 1-106) is available with a His-tag for purification purposes . For experimental studies, this recombinant version provides researchers with sufficient quantities of purified protein for functional, structural, and interaction analyses. The E. coli expression system is preferred due to its rapid growth, high protein yields, and well-established protocols for protein induction and purification. Alternative expression systems, including yeast or insect cells, might be considered if the protein requires specific post-translational modifications for activity.

What are the physical and chemical properties of Atu2659.1?

Atu2659.1 is a relatively small protein consisting of 106 amino acids in its full-length form . While detailed structural information is limited due to its uncharacterized nature, researchers can predict several properties based on the primary sequence:

PropertyPredicted Value/Range
Molecular WeightApproximately 10-12 kDa (excluding tags)
Theoretical pIVaries based on amino acid composition
SolubilityLikely soluble based on successful recombinant expression
StabilityMay require optimization for long-term storage
DomainsUnknown functional domains (requires prediction tools)

Researchers should perform protein structure prediction analyses and biochemical characterization to further understand these properties.

What is the recommended experimental design for studying Atu2659.1 function?

When designing experiments to study Atu2659.1 function, researchers should employ a completely randomized design with appropriate controls to minimize bias and variability . A systematic approach includes:

  • Protein purification and quality control: Ensure high-quality recombinant protein using His-tag affinity purification followed by size exclusion chromatography.

  • Initial screening: Conduct broad screens for potential biological activities, including DNA/RNA binding, enzymatic activities, and protein-protein interactions.

  • Comparative analysis: Include related proteins from A. tumefaciens with known functions as positive controls.

  • Statistical analysis: Implement ANOVA with Tukey's post-hoc test for experimental validation, using a 95% confidence interval to determine statistical significance .

  • Cross-validation: Confirm results using multiple methodological approaches to strengthen findings.

This design helps account for experimental variability while providing robust data on protein function.

How can I validate the expression and purification of recombinant Atu2659.1?

Validating recombinant Atu2659.1 expression and purification requires a multi-step approach:

  • SDS-PAGE analysis: Confirm the presence of a protein band at the expected molecular weight (approximately 10-12 kDa plus tag size).

  • Western blot: Use anti-His antibodies to verify the presence of the His-tagged protein.

  • Mass spectrometry: Conduct TMT-MS (Tandem Mass Tag-Mass Spectrometry) analysis to confirm protein identity and purity .

  • Size exclusion chromatography: Assess protein homogeneity and oligomerization state.

  • Activity assays: Develop preliminary function-based assays based on bioinformatic predictions.

For quantitative analysis, correlation with known standards should be performed, aiming for correlation coefficients of r ≥ |0.70| (p ≤ 0.01) to ensure reliable quantification .

What bioinformatic approaches can help predict Atu2659.1 function?

To predict Atu2659.1 function, researchers should employ multiple bioinformatic approaches:

  • Sequence homology analysis: Compare Atu2659.1 sequence with characterized proteins using BLAST and HHpred to identify distant homologs.

  • Structural prediction: Use AlphaFold2 or similar tools to predict tertiary structure, which may reveal functional domains.

  • Genomic context analysis: Examine neighboring genes in the A. tumefaciens genome to identify potential functional relationships based on operonic structure.

  • Protein-protein interaction predictions: Use STRING database methods to identify potential interaction partners .

  • Conservation analysis: Analyze sequence conservation across Agrobacterium species to identify critical residues.

Integration of these methods provides a comprehensive approach to generating testable hypotheses about Atu2659.1 function within the context of A. tumefaciens biology.

How can I determine if Atu2659.1 plays a role in Agrobacterium-mediated plant transformation?

Investigating the potential role of Atu2659.1 in Agrobacterium-mediated plant transformation requires a systematic approach:

  • Gene knockout studies: Create a precise deletion of the atu2659.1 gene in A. tumefaciens using CRISPR-Cas9 or homologous recombination methods.

  • Complementation assays: Reintroduce the wild-type or mutant versions of the gene to assess functional recovery.

  • Transformation efficiency assays: Quantitatively compare the ability of wild-type and mutant strains to transform plant cells, using established protocols with model plant systems.

  • Localization studies: Express fluorescently tagged versions of Atu2659.1 to determine its subcellular localization during the transformation process.

  • Interaction studies: Perform co-immunoprecipitation or yeast two-hybrid assays to identify potential interactions with known components of the T-DNA transfer machinery.

Analysis should include statistical assessment using ANOVA followed by Tukey's post-hoc test with p < 0.05 considered significant . This comprehensive approach will help determine whether Atu2659.1 contributes to the transformation process, possibly in attachment, Vir gene activation, T-complex formation, or T-DNA integration steps .

What proteomics approaches are most suitable for studying Atu2659.1 interactions?

For studying Atu2659.1 protein interactions, several advanced proteomics approaches are recommended:

  • TMT-MS discovery proteomics: This quantitative approach allows for the identification of proteins that co-purify with Atu2659.1 under different conditions . The method should be validated using known protein standards with correlation coefficients of r ≥ |0.50| (p ≤ 0.01).

  • Cross-linking mass spectrometry (XL-MS): This technique identifies proteins in close physical proximity to Atu2659.1 by creating covalent bonds between nearby proteins before analysis.

  • Proximity-dependent biotin identification (BioID): By fusing Atu2659.1 to a biotin ligase, proteins in close proximity become biotinylated and can be subsequently identified.

  • Co-immunoprecipitation followed by MS: Using antibodies against Atu2659.1 or its tag to pull down protein complexes for identification.

  • Hierarchical cluster analysis: Apply Wald's method with Euclidean distance squared to analyze interaction data and identify protein clusters functionally related to Atu2659.1 .

These approaches provide complementary data that, when integrated, offer a comprehensive view of the protein interaction network surrounding Atu2659.1.

How do I analyze contradictory results in Atu2659.1 functional studies?

When faced with contradictory results in Atu2659.1 functional studies, researchers should follow this systematic approach:

  • Methodological assessment: Evaluate differences in experimental protocols, protein preparation, buffer conditions, and assay systems that might explain discrepancies.

  • Statistical re-evaluation: Perform exploratory factor analysis on variables using the principal component method to identify underlying patterns in the data .

  • Biological context considerations: Assess whether different growth conditions, bacterial strains, or environmental factors might influence protein function.

  • Post-translational modifications: Investigate whether the protein undergoes modifications that could alter its function in different experimental contexts.

  • Technical validation: Employ multiple independent techniques to verify results, avoiding reliance on a single methodology.

When reporting contradictory findings, clearly document all experimental conditions, statistical approaches, and limitations to help the research community interpret the results appropriately.

What experimental approaches can determine if Atu2659.1 interacts with plant proteins during infection?

To determine if Atu2659.1 interacts with plant proteins during infection, researchers should implement a multi-faceted approach:

  • Yeast two-hybrid screening: Screen Atu2659.1 against plant cDNA libraries to identify potential interaction partners.

  • In planta co-immunoprecipitation: Express tagged versions of Atu2659.1 in plants, followed by pull-down assays and mass spectrometry identification of interacting proteins.

  • Bimolecular fluorescence complementation (BiFC): Visualize protein interactions in living plant cells by expressing Atu2659.1 and candidate plant proteins fused to complementary fragments of a fluorescent protein.

  • Surface plasmon resonance (SPR): Quantitatively measure binding affinities between purified Atu2659.1 and candidate plant proteins.

  • In vitro pull-down assays: Validate direct interactions using purified recombinant proteins.

Data should be analyzed using appropriate statistical methods, including ANOVA for comparing multiple conditions and Tukey's post-hoc test for identifying specific differences between experimental groups . Interactions should be confirmed using at least two independent methods to minimize false positives.

How can evolutionary analysis help understand the function of Atu2659.1?

Evolutionary analysis provides valuable insights into Atu2659.1 function through several approaches:

  • Phylogenetic profiling: Identify the presence or absence of Atu2659.1 homologs across bacterial species, particularly focusing on plant pathogens versus non-pathogens.

  • Selection pressure analysis: Calculate dN/dS ratios across the protein sequence to identify regions under purifying or positive selection, indicating functional importance.

  • Ancestral sequence reconstruction: Infer the evolutionary history of the protein to understand functional shifts over time.

  • Comparative genomic context: Analyze the conservation of gene neighborhoods across related species to identify functional associations.

  • Horizontal gene transfer assessment: Determine if atu2659.1 shows evidence of horizontal acquisition, which might indicate adaptation to specific ecological niches.

This evolutionary perspective can reveal whether Atu2659.1 represents a conserved bacterial function or a specialized adaptation related to the plant-microbe interaction capabilities of A. tumefaciens .

What gene knockout and complementation strategies are most effective for studying Atu2659.1?

For effective gene knockout and complementation studies of Atu2659.1, researchers should consider the following approaches:

  • Precise gene deletion: Use homologous recombination or CRISPR-Cas9 to create clean deletions without polar effects on surrounding genes.

  • Marker-free systems: Implement two-step selection procedures to remove antibiotic resistance markers after mutation confirmation.

  • Complementation vectors: Utilize stable broad-host-range plasmids with tunable promoters (such as Ptet or PBAD) to control expression levels.

  • Site-directed mutagenesis: Create point mutations in conserved residues to identify critical amino acids for function.

  • Conditional expression systems: Employ inducible promoters to study essential genes or toxic protein effects.

When designing complementation experiments, researchers should ensure proper experimental controls, including:

Control TypePurpose
Empty vectorControls for vector effects
Wild-type strainPositive control for normal function
Deletion mutantNegative control for loss of function
Point mutantsIdentifies critical residues
Heterologous complementationTests functional conservation

Statistical analysis should include appropriate randomized design principles with ANOVA followed by Tukey's post-hoc test for significant differences (p < 0.05) .

What are the key challenges in studying uncharacterized proteins like Atu2659.1?

Studying uncharacterized proteins like Atu2659.1 presents several significant challenges:

  • Lack of preliminary functional data: Without known functions, designing targeted assays requires broad screening approaches.

  • Potential moonlighting functions: The protein may have multiple biological roles depending on conditions or cellular location.

  • Expression and solubility issues: Optimizing conditions for recombinant expression might require extensive troubleshooting.

  • Structural characterization difficulties: Without structural data, understanding mechanism remains challenging.

  • Validation across experimental systems: Confirming findings in heterologous systems versus native conditions requires careful control design.

Researchers should address these challenges through integrated approaches combining computational predictions, high-throughput screening, and targeted experimental validation. Collaborative efforts across specialties (structural biology, biochemistry, plant pathology) may accelerate progress in understanding this protein's role in A. tumefaciens biology.

How might understanding Atu2659.1 contribute to advancements in plant genetic engineering?

Understanding Atu2659.1 could potentially advance plant genetic engineering in several ways:

  • Improved transformation efficiency: If Atu2659.1 influences the plant transformation process, modifying its expression or activity could enhance transformation rates in recalcitrant species.

  • Extended host range: Identifying host factors that interact with Atu2659.1 might reveal strategies to expand the range of transformable plant species.

  • Novel vector development: Understanding the protein's role could inspire the design of improved binary and co-integrative vector systems for plant transformation .

  • Target-specific delivery: If Atu2659.1 mediates specific interactions with plant tissues, this knowledge could enable tissue-specific transformation strategies.

  • Reduced transformation side effects: Understanding all components involved in transformation could help minimize unintended consequences in engineered plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.