Recombinant Agrobacterium tumefaciens Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Description

Comprehensive Analysis of Recombinant Agrobacterium tumefaciens Undecaprenyl-diphosphatase 1 (uppP1)

Recombinant Agrobacterium tumefaciens Undecaprenyl-diphosphatase 1 (uppP1) represents a critical enzyme in bacterial cell wall biosynthesis that catalyzes the dephosphorylation of undecaprenyl diphosphate to undecaprenyl phosphate. This essential process enables the recycling of the lipid carrier responsible for transporting peptidoglycan precursors across the bacterial membrane. The enzyme, identified by UniProt accession number P58740, is also known as Bacitracin resistance protein 1 and plays a vital role in maintaining cellular integrity and antibiotic resistance in A. tumefaciens. Recent research has explored its biochemical properties, structural characteristics, and potential as an antimicrobial target. This article provides a comprehensive examination of this enzyme's properties, functions, and significance in bacterial physiology and pathogenesis.

Biology and Characteristics

Agrobacterium tumefaciens is a rod-shaped, gram-negative soil bacterium belonging to the Alphaproteobacteria class. It has gained prominence in the scientific community for its unique ability to transfer DNA fragments to plant cells, causing crown gall disease in infected plants . This natural genetic engineering capability has been extensively exploited in plant biotechnology for genetic transformation, making A. tumefaciens one of the most important tools in plant genetic engineering.

Pathogenesis and Surface Interactions

A. tumefaciens produces adhesive polysaccharide structures at one end of the rod-shaped cell, known as unipolar polysaccharides (UPP), which enable surface attachment and biofilm formation. These structures are produced on both biotic and abiotic surfaces and can be observed using polysaccharide-specific labeling dyes as well as by fluorescence and electron microscopy . The pathogen's ability to attach to plant surfaces is crucial for its infection process, and the UPP plays a central role in this interaction.

Genetic Organization

The genome of A. tumefaciens strain C58 (ATCC 33970) has been fully sequenced and annotated, providing valuable insights into its biological processes. The uppP1 gene (also known as bacA1 or upk1) is identified by the ordered locus name Atu0294 and the ORF name AGR_C_505 . This genetic information has facilitated the production of recombinant uppP1 for research and biochemical studies.

Enzymatic Function

Undecaprenyl-diphosphatase 1 (uppP1) is classified as EC 3.6.1.27, which designates it as a phosphoric diester hydrolase . The enzyme catalyzes the following reaction:

Undecaprenyl diphosphate + H₂O → Undecaprenyl phosphate + Phosphate

This reaction is critical for the recycling of undecaprenyl phosphate (Und-P), an essential lipid carrier that ferries cell wall intermediates across the cytoplasmic membrane in bacteria . The regeneration of Und-P from undecaprenyl diphosphate (Und-PP) ensures the continuous synthesis of peptidoglycan and other cell wall components.

Table 1: Biochemical Properties of Recombinant A. tumefaciens Undecaprenyl-diphosphatase 1 (uppP1)

PropertyDescription
Enzyme classificationEC 3.6.1.27
Alternative namesBacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1
Gene namesuppP1, bacA1, upk1
Ordered Locus NamesAtu0294
ORF NamesAGR_C_505
Length268 amino acids
UniProt IDP58740
Expression systemRecombinant protein expression systems
Storage conditions-20°C or -80°C in Tris-based buffer with 50% glycerol
StabilityRepeated freezing and thawing not recommended

Role in Cell Wall Biosynthesis

Undecaprenyl phosphate serves as an essential lipid carrier that transports peptidoglycan precursors from the cytoplasm to the periplasmic space in gram-negative bacteria. The recycling of Und-PP to Und-P, catalyzed by enzymes like uppP1, is a critical step in the peptidoglycan biosynthesis pathway . After the peptidoglycan precursor is transferred to the growing cell wall, the lipid carrier is released as Und-PP and must be dephosphorylated to Und-P to participate in another round of cell wall synthesis.

The continuous recycling of Und-P is essential for maintaining cell wall integrity, especially during active growth and division. Disruption of this process can lead to defects in cell wall synthesis, affecting bacterial growth, division, and survival. In A. tumefaciens, proper cell wall biosynthesis is not only essential for survival but also for pathogenesis and host interaction.

Relationship to Antibiotic Resistance

The undecaprenyl-diphosphatase activity of uppP1 contributes to bacitracin resistance in bacteria. Bacitracin is an antibiotic that binds to Und-PP, preventing its dephosphorylation and thus inhibiting cell wall synthesis. By efficiently dephosphorylating Und-PP to Und-P, uppP1 reduces the pool of Und-PP available for bacitracin binding, thereby conferring resistance to this antibiotic .

System-wide Connections

Research has uncovered system-wide connections between undecaprenyl phosphate metabolism and various cellular processes. A genetic screen in Escherichia coli revealed that defects in Und-P recycling affect multiple cellular systems, including cell division, DNA replication and repair, signal transduction, and glutathione metabolism . These findings suggest that uppP1 and related enzymes are integrated into broader cellular networks, influencing diverse aspects of bacterial physiology beyond cell wall biosynthesis.

Homologs in Different Bacteria

Undecaprenyl diphosphate phosphatases are conserved across bacterial species, reflecting their essential role in cell wall biosynthesis. In Escherichia coli, four enzymes - BacA, PgpB, YbjG, and LpxT - have been identified to dephosphorylate Und-PP . Among these, BacA is considered the primary phosphatase, responsible for approximately 75% of the Und-PP phosphatase activity in the cell.

Table 2: Comparative Analysis of Undecaprenyl Diphosphate Phosphatases in Different Bacterial Species

FeatureA. tumefaciens uppP1E. coli BacAE. coli PgpBE. coli YbjGE. coli LpxT
Primary FunctionUnd-PP dephosphorylationUnd-PP dephosphorylationUnd-PP dephosphorylationUnd-PP dephosphorylationUnd-PP dephosphorylation and lipid A phosphorylation
Genetic EssentialityUnknownConditionally essentialConditionally essentialConditionally essentialConditionally essential
Contribution to ActivityUnknown~75%~20% (combined with YbjG)~20% (combined with PgpB)Minor
Membrane AssociationYesYesYesYesYes
Antibiotic ResistanceBacitracin resistanceBacitracin resistanceBacitracin resistanceBacitracin resistanceUnknown

Evolutionary Conservation

The conservation of undecaprenyl diphosphate phosphatases across diverse bacterial species highlights their fundamental importance in bacterial physiology. While the core enzymatic function is preserved, variations in sequence, structure, and regulation may reflect adaptations to different ecological niches and environmental pressures. The study of these variations can provide insights into bacterial evolution and adaptation.

Antibiotic Development

Undecaprenyl diphosphate phosphatases represent attractive targets for antibiotic development due to their essential role in bacterial cell wall biosynthesis. Compounds targeting undecaprenyl diphosphate phosphatase (UPPP) and undecaprenyl diphosphate synthase (UPPS) have shown inhibitory effects on bacterial growth, particularly against Staphylococcus aureus and Bacillus subtilis .

Notably, these inhibitors act synergistically with antibiotics known to target bacterial cell-wall biosynthesis. A study found that compounds like 5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid (compound 7) demonstrated synergistic effects with seven antibiotics targeting cell wall biosynthesis, with a fractional inhibitory concentration index (FICI) of approximately 0.35. In contrast, the same compounds showed indifferent effects when combined with antibiotics targeting other cellular processes (average FICI ~1.45) . This synergistic effect highlights the potential of UPPP inhibitors as adjuvants to existing antibiotics, potentially enhancing their efficacy and helping to combat antibiotic resistance.

Biotechnological Applications

The study of A. tumefaciens uppP1 has implications for biotechnology, particularly in the field of plant genetic engineering. Given A. tumefaciens' natural ability to transfer DNA to plants, understanding and manipulating its cell wall biosynthesis pathways could lead to improved genetic transformation methods. Additionally, insights into the structure and function of uppP1 could inform the design of biomolecules with novel properties for various biotechnological applications.

Table 3: Potential Applications of A. tumefaciens uppP1 Research

Application AreaDescriptionCurrent Status
Antibiotic DevelopmentTarget for novel antibiotics or adjuvantsActive research area with promising compounds identified
Plant TransformationEnhanced efficiency of A. tumefaciens-mediated transformationOngoing research into optimizing bacterial attachment and DNA transfer
Synthetic BiologyEngineering bacteria with modified cell wall propertiesEmerging field with potential applications in industrial biotechnology
Structural BiologyModel for membrane-associated phosphatasesLimited structural data available, active area for future research
Diagnostic ToolsDevelopment of tools to detect and study bacterial infectionsPotential application, limited current research

Recombinant Protein Expression

Recombinant A. tumefaciens uppP1 can be produced using standard protein expression systems. The gene encoding uppP1 is cloned into an appropriate expression vector and transformed into a suitable host, typically Escherichia coli. The expression region typically encompasses residues 1-268, covering the full-length protein .

The recombinant protein may be tagged for purification purposes, although the specific tag type is often determined during the production process based on the specific requirements of the experiment or application. Common tags include polyhistidine (His) tags, glutathione S-transferase (GST) tags, or maltose-binding protein (MBP) tags.

Analytical Methods

Various analytical methods can be employed to study the structure, function, and interactions of recombinant uppP1:

  1. Enzyme Activity Assays: These assays measure the phosphatase activity of uppP1 using undecaprenyl diphosphate as a substrate. The release of inorganic phosphate can be quantified using colorimetric methods.

  2. Structural Analysis: Techniques such as X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, and cryo-electron microscopy can provide insights into the three-dimensional structure of uppP1.

  3. Inhibition Studies: The effects of potential inhibitors on uppP1 activity can be assessed through enzyme inhibition assays. Compounds showing significant inhibition can be further evaluated for their antimicrobial properties.

  4. Protein-Protein Interaction Studies: Methods such as co-immunoprecipitation, yeast two-hybrid assays, and surface plasmon resonance can reveal interactions between uppP1 and other proteins in the cell wall biosynthesis pathway.

Recent Advances

Recent research has expanded our understanding of undecaprenyl diphosphate phosphatases in various bacteria. Studies in E. coli have revealed synthetic interactions between undecaprenyl phosphate metabolism and various cellular processes, including cell division, DNA replication, and signal transduction . These findings suggest that uppP1 and related enzymes are integrated into complex cellular networks.

In the field of antibiotic development, compounds targeting both undecaprenyl diphosphate phosphatase (UPPP) and undecaprenyl diphosphate synthase (UPPS) have shown promising antibacterial activity. The synergistic effects of these compounds with existing cell wall-targeting antibiotics highlight their potential as adjuvants in combination therapy .

Future Research Directions

Several promising research directions could enhance our understanding of A. tumefaciens uppP1 and its applications:

  1. Structural Studies: Detailed structural analysis of uppP1 could provide insights into its catalytic mechanism and inform the design of specific inhibitors.

  2. Functional Genomics: Comprehensive genetic screens in A. tumefaciens could reveal the full scope of uppP1's interactions with other cellular processes and components.

  3. Synthetic Biology Applications: Engineering uppP1 variants with altered properties could lead to novel applications in biotechnology, such as improved plant transformation methods or the production of modified cell wall components.

  4. Drug Discovery: High-throughput screening of compound libraries could identify novel inhibitors of uppP1 with potential antimicrobial activity.

  5. Systems Biology Approaches: Integrating data from genomics, proteomics, and metabolomics could provide a holistic view of uppP1's role in bacterial physiology and pathogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
uppP1; bacA1; upk1; Atu0294; AGR_C_505; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
uppP1
Target Protein Sequence
MGDQSIISALLLGIIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL VYFQKLVSIAVAMPTSAKARRFVLAVLVAFLPAAVIGALAHDFIKTVLFETPMLICVVLI IGGFILLAVDRMPLKPKYTDIMDYPPSLAFKIGLFQCLAMIPGTSRSGATIVGALLMGTD KRSAAEFSFFLAMPTMLGAFVLDLYKNRDALSFDDSALIAVGFVAAFVSGLFVVRSLLDF VSRRGFAPFAWWRIVIGALGLVALLVIG
Uniprot No.

Target Background

Function
This recombinant *Agrobacterium tumefaciens* Undecaprenyl-diphosphatase 1 (UppP1) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links

KEGG: atu:Atu0294

STRING: 176299.Atu0294

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 1 (uppP1) and what is its role in Agrobacterium tumefaciens?

Undecaprenyl-diphosphatase 1 (uppP1) is a transmembrane protein encoded by the uppP1 gene in Agrobacterium tumefaciens. It functions as an enzyme (EC 3.6.1.27) that catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which is a critical step in bacterial cell wall biosynthesis. This enzyme plays a key role in the recycling of the lipid carrier required for peptidoglycan synthesis and contributes to bacterial resistance against certain antibiotics, particularly bacitracin, which targets this pathway .

The protein is also known by alternative names including Bacitracin resistance protein 1 and Undecaprenyl pyrophosphate phosphatase 1. In Agrobacterium tumefaciens strain C58 (also classified as Agrobacterium fabrum), uppP1 consists of 268 amino acids and contains multiple transmembrane domains that anchor it within the bacterial cell membrane .

What are the optimal storage conditions for Recombinant Agrobacterium tumefaciens Undecaprenyl-diphosphatase 1?

For optimal preservation of recombinant uppP1 activity and stability, the following storage conditions are recommended:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C

  • Extended storage: Conserve at -20°C or -80°C

It is important to note that repeated freezing and thawing cycles should be avoided as they can significantly compromise protein integrity and enzymatic activity . The table below summarizes the recommended storage conditions and shelf life for different formulations of the protein:

FormulationStorage TemperatureApproximate Shelf Life
Liquid form-20°C/-80°C6 months
Lyophilized form-20°C/-80°C12 months
Working aliquots4°CUp to 1 week

The shelf life is influenced by multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself .

How is recombinant uppP1 typically expressed and purified for research purposes?

Recombinant Agrobacterium tumefaciens uppP1 is typically expressed using an in vitro E. coli expression system . The common approach involves the following methodology:

  • Construct design: The uppP1 gene (encoding the full-length protein of 268 amino acids) is cloned into an expression vector with an N-terminal 10xHis-tag for facilitated purification .

  • Expression conditions: The protein is expressed in E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) under controlled temperature conditions, typically at lower temperatures (16-25°C) to enhance proper folding.

  • Membrane extraction: Since uppP1 is a transmembrane protein, specialized detergent-based extraction methods are employed to solubilize the protein from bacterial membranes.

  • Purification process:

    • Initial purification via immobilized metal affinity chromatography (IMAC) using the N-terminal 10xHis-tag

    • Further purification through size exclusion chromatography (SEC)

    • Quality assessment using SDS-PAGE and Western blotting

  • Buffer optimization: The protein is typically maintained in detergent-containing buffers to preserve its native conformation and enzymatic activity.

How does uppP1 contribute to bacterial cell wall synthesis?

Undecaprenyl-diphosphatase 1 plays a crucial role in the peptidoglycan biosynthesis pathway of Agrobacterium tumefaciens through the following mechanisms:

  • Lipid carrier recycling: UppP1 catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), enabling the recycling of this essential lipid carrier molecule.

  • Peptidoglycan precursor transport: The undecaprenyl phosphate generated by uppP1 serves as a carrier for peptidoglycan precursors across the cytoplasmic membrane.

  • Cell wall expansion: By facilitating the continuous supply of undecaprenyl phosphate, uppP1 supports ongoing cell wall biosynthesis required for bacterial growth and division.

  • Antibiotic resistance: UppP1 contributes to bacterial resistance against antibiotics like bacitracin, which specifically targets the undecaprenyl phosphate pathway, explaining its alternative name "Bacitracin resistance protein 1" .

This enzymatic activity is essential for bacterial survival, making uppP1 and related enzymes potential targets for antimicrobial development.

What experimental approaches are most effective for studying the enzymatic activity of uppP1?

Several complementary experimental approaches can be employed to effectively study the enzymatic activity of recombinant uppP1:

  • Radiometric assays:

    • Using radiolabeled substrates (typically [³²P]-labeled undecaprenyl pyrophosphate)

    • Quantifying the release of inorganic phosphate through scintillation counting

    • Advantages: High sensitivity and direct measurement of product formation

  • Colorimetric phosphate detection assays:

    • Malachite green assay for detecting inorganic phosphate release

    • Continuous monitoring using coupled enzyme systems

    • Advantages: Allows for high-throughput screening and doesn't require radioactive materials

  • Fluorescence-based assays:

    • Using fluorescent substrate analogs that change emission properties upon dephosphorylation

    • Real-time monitoring of reaction kinetics

    • Advantages: High sensitivity and ability to perform continuous measurements

  • Surface plasmon resonance (SPR):

    • Analysis of binding interactions between uppP1 and potential inhibitors or substrates

    • Determination of binding kinetics and affinity constants

    • Advantages: Label-free detection and real-time measurements

How can I troubleshoot expression issues when working with recombinant uppP1?

When encountering expression issues with recombinant Agrobacterium tumefaciens uppP1, consider the following troubleshooting approaches:

  • Low expression yield:

    • Optimize codon usage for the expression host

    • Test different E. coli expression strains specialized for membrane proteins

    • Reduce expression temperature to 16-20°C to improve proper folding

    • Consider using stronger or more tightly regulated promoters

  • Protein insolubility:

    • Test different detergents for membrane extraction (DDM, LDAO, CHAPS)

    • Optimize detergent concentration for efficient solubilization without denaturing the protein

    • Consider fusion with solubility-enhancing tags (MBP, SUMO)

    • Adjust pH and ionic strength of extraction buffers

  • Protein aggregation:

    • Add stabilizing agents such as glycerol (10-20%)

    • Include specific lipids that might be required for proper folding

    • Consider nanodiscs or other membrane mimetics for stabilization

    • Adjust purification conditions to minimize time at room temperature

  • Loss of activity:

    • Include protease inhibitors throughout purification

    • Add reducing agents to prevent oxidation of cysteine residues

    • Test different buffer compositions to maintain native conformation

    • Consider reconstitution into liposomes to restore activity

What are the key considerations for designing inhibitors of Undecaprenyl-diphosphatase 1?

When designing potential inhibitors for Undecaprenyl-diphosphatase 1, researchers should consider several important factors:

  • Substrate mimicry:

    • Design compounds that mimic the structural features of the natural substrate (undecaprenyl pyrophosphate)

    • Incorporate phosphonate or phosphate isosteres that can interact with the active site

    • Consider the length and hydrophobicity of the lipid chain portion

  • Membrane permeability:

    • Since uppP1 is a transmembrane protein, inhibitors must be able to access the active site within the membrane environment

    • Balance hydrophobicity and hydrophilicity for optimal membrane partitioning

    • Consider using targeted delivery approaches for highly polar compounds

  • Selectivity considerations:

    • Design features that distinguish bacterial uppP1 from host phosphatases

    • Target unique structural features not present in eukaryotic homologs

    • Consider the differences between uppP1 and other bacterial phosphatases

  • Structure-based design approach:

    • Utilize homology models based on related bacterial phosphatases

    • Apply molecular docking to predict binding modes of potential inhibitors

    • Implement fragment-based drug discovery approaches

How does uppP1 from Agrobacterium tumefaciens compare to homologous proteins in other bacterial species?

Undecaprenyl-diphosphatase 1 from Agrobacterium tumefaciens shares several features with homologous proteins from other bacterial species, but also exhibits important differences:

  • Sequence conservation:

    • The core catalytic domains show moderate to high sequence conservation among bacterial species

    • The transmembrane topology is generally preserved across different bacterial phosphatases

    • Specific residues involved in catalysis are highly conserved

  • Structural variations:

    • The number and arrangement of transmembrane helices may vary between species

    • The size and composition of loop regions connecting transmembrane segments show greater variability

    • Species-specific insertions or deletions may be present in certain regions

  • Substrate specificity:

    • While the primary function (dephosphorylation of undecaprenyl pyrophosphate) is conserved, subtle differences in active site architecture may influence substrate recognition

    • Some homologs may show broader substrate specificity than others

  • Inhibitor sensitivity:

    • Differential sensitivity to various inhibitors, including antibiotics like bacitracin

    • Species-specific variations in binding pockets can influence inhibitor efficacy

This comparative understanding is crucial for developing targeted antimicrobial strategies that exploit unique features of specific bacterial species.

What role does uppP1 play in bacterial resistance to antibiotics like bacitracin?

Undecaprenyl-diphosphatase 1 contributes significantly to bacterial resistance against certain antibiotics, particularly bacitracin:

  • Mechanism of bacitracin action:

    • Bacitracin binds to undecaprenyl pyrophosphate, preventing its dephosphorylation

    • This inhibits the recycling of the lipid carrier required for cell wall synthesis

    • Ultimately, this leads to disruption of bacterial cell wall formation and bacterial death

  • UppP1's role in resistance:

    • Increased expression or activity of uppP1 accelerates the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate

    • This reduces the pool of the bacitracin target (undecaprenyl pyrophosphate)

    • The increased rate of lipid carrier recycling helps maintain cell wall synthesis despite the presence of the antibiotic

  • Resistance mechanisms:

    • Point mutations in uppP1 can reduce its affinity for bacitracin while maintaining catalytic activity

    • Overexpression of uppP1 can overcome the inhibitory effects of bacitracin through mass action

    • Alternative pathways for lipid carrier recycling may be upregulated

How should I interpret contradictory data when studying uppP1 enzymatic activity?

When faced with contradictory data during uppP1 research, follow these methodological approaches:

  • Thoroughly examine the data:

    • Identify specific discrepancies between expected and observed results

    • Compare results with existing literature on related bacterial phosphatases

    • Pay special attention to outliers that may have influenced the results

  • Evaluate experimental conditions:

    • Assess variability in protein preparation methods (expression, purification)

    • Consider the influence of different detergents or membrane mimetics on activity

    • Examine buffer composition, pH, temperature, and other reaction conditions

  • Consider alternative hypotheses:

    • Explore whether uppP1 might have additional, previously unrecognized functions

    • Investigate whether other enzymes might be contributing to the observed activity

    • Evaluate the possibility of post-translational modifications affecting activity

  • Implement additional controls:

    • Include site-directed mutants (e.g., catalytic residue mutations) as negative controls

    • Compare with well-characterized phosphatases as positive controls

    • Use multiple orthogonal assay techniques to verify activity measurements

  • Refine experimental approach:

    • Implement more sensitive or selective detection methods

    • Consider using purified native enzyme rather than recombinant protein

    • Explore the effects of potential cofactors or activators

Source of ContradictionInvestigation ApproachPossible Resolution
Protein preparationCompare different expression/purification methodsIdentify optimal conditions for active protein
Assay conditionsSystematic variation of pH, temperature, ionic strengthDetermine optimal reaction parameters
Substrate preparationTest different substrate sources and puritiesIdentify potential contamination issues
Detection methodCompare multiple detection techniquesIdentify most reliable quantification approach

What are the best methods for studying uppP1 in its native membrane environment?

To study uppP1 in a more native-like membrane environment, consider these methodological approaches:

  • Liposome reconstitution:

    • Purify recombinant uppP1 and reconstitute into liposomes of defined lipid composition

    • Control lipid composition to mimic bacterial membranes

    • Measure activity using radiometric or colorimetric assays

    • Advantages: Defined system with controlled lipid environment

  • Nanodiscs technology:

    • Incorporate uppP1 into membrane scaffold protein (MSP)-bounded lipid bilayers

    • Maintain the protein in a native-like environment while enhancing stability

    • Compatible with various biophysical and structural biology techniques

    • Advantages: Soluble particles suitable for many analytical techniques

  • Bacterial membrane vesicles:

    • Express uppP1 in bacteria and isolate membrane vesicles

    • Minimal perturbation of the native membrane environment

    • Measure activity directly in the vesicle preparation

    • Advantages: Preserves interactions with native membrane components

  • In vivo activity assays:

    • Generate bacterial strains with modified uppP1 expression

    • Assess phenotypic changes like antibiotic sensitivity

    • Complement deletion strains with mutant variants

    • Advantages: Directly measures biological relevance of activity

How can gene editing techniques be applied to study uppP1 function in Agrobacterium tumefaciens?

Modern gene editing approaches offer powerful tools for investigating uppP1 function in its native organism:

  • CRISPR-Cas9 genome editing:

    • Generate precise gene knockouts of uppP1

    • Create point mutations to study specific amino acid contributions

    • Introduce tagged versions for localization studies

    • Assess phenotypic consequences of uppP1 modification

  • Controlled expression systems:

    • Replace native promoter with inducible promoters

    • Create conditional knockdowns using antisense RNA or CRISPRi

    • Generate strains with titratable uppP1 expression

    • Study dose-dependent effects of uppP1 levels

  • Reporter fusion constructs:

    • Generate translational fusions with fluorescent proteins

    • Monitor expression levels and localization patterns

    • Create transcriptional fusions to study gene regulation

    • Identify conditions that modulate uppP1 expression

  • Complementation analysis:

    • Express heterologous phosphatases in uppP1-deficient strains

    • Test chimeric proteins to identify functional domains

    • Introduce site-directed mutants to pinpoint catalytically important residues

    • Assess rescue of growth, morphology, or antibiotic sensitivity phenotypes

How can X-ray crystallography or cryo-EM be optimized for structural studies of uppP1?

Obtaining high-resolution structural information for membrane proteins like uppP1 presents unique challenges that require specialized approaches:

  • Protein stabilization strategies:

    • Screen multiple detergents to identify optimal solubilization conditions

    • Consider lipidic cubic phase (LCP) crystallization for membrane proteins

    • Use antibody fragments or nanobodies to stabilize specific conformations

    • Engineer constructs with thermostabilizing mutations or fusion partners

  • Crystallization optimization:

    • Implement high-throughput screening of crystallization conditions

    • Consider lipid-based crystallization methods (bicelles, LCP)

    • Explore co-crystallization with substrates, product analogs, or inhibitors

    • Test surface entropy reduction mutations to promote crystal contacts

  • Cryo-EM sample preparation:

    • Reconstitute in nanodiscs or amphipols for single-particle cryo-EM

    • Optimize grid preparation parameters (blotting time, temperature)

    • Consider using focused ion beam milling for membrane-embedded proteins

    • Test different detergent or nanodisc compositions

  • Data collection and processing:

    • Collect diffraction data at microfocus beamlines for microcrystals

    • Implement advanced data processing methods for anisotropic diffraction

    • For cryo-EM, use motion correction and particle classification strategies

    • Consider combining multiple structural approaches for comprehensive analysis

What molecular dynamics simulation approaches are suitable for studying uppP1 function?

Molecular dynamics (MD) simulations provide valuable insights into the conformational dynamics and function of membrane proteins like uppP1:

  • System preparation:

    • Build homology models based on related bacterial phosphatases if experimental structures are unavailable

    • Embed the protein in a lipid bilayer that mimics bacterial membrane composition

    • Include explicit solvent and appropriate counterions

    • Carefully parameterize substrate and potential inhibitor molecules

  • Simulation protocols:

    • Perform equilibration with gradual restraint release

    • Run production simulations on microsecond timescales when possible

    • Consider enhanced sampling methods (metadynamics, umbrella sampling) for rare events

    • Implement replica exchange simulations to improve conformational sampling

  • Analysis approaches:

    • Analyze protein conformational changes during substrate binding and catalysis

    • Identify water molecules involved in the catalytic mechanism

    • Calculate binding free energies for substrates or inhibitors

    • Characterize protein-lipid interactions that may influence activity

  • Advanced techniques:

    • Implement QM/MM simulations to study the reaction mechanism

    • Use Markov state modeling to identify key intermediates

    • Apply network analysis to identify allosteric communication pathways

    • Consider coarse-grained simulations for processes occurring on longer timescales

What are the emerging research areas for uppP1 and related phosphatases?

The study of Undecaprenyl-diphosphatase 1 from Agrobacterium tumefaciens and related bacterial phosphatases continues to evolve, with several promising research directions:

  • Structural biology advancements:

    • Determination of high-resolution structures in different conformational states

    • Capturing enzyme-substrate and enzyme-inhibitor complexes

    • Elucidating the complete catalytic mechanism at the molecular level

  • Drug discovery applications:

    • Development of selective inhibitors as potential antibacterial agents

    • Structure-based design of novel compounds targeting the lipid carrier cycle

    • Exploration of natural products that may target this pathway

  • Systems biology integration:

    • Understanding the regulatory networks controlling uppP1 expression

    • Mapping interactions between uppP1 and other components of cell wall biosynthesis

    • Quantitative modeling of lipid carrier recycling in bacterial physiology

  • Comparative biology:

    • Comprehensive analysis of uppP1 homologs across bacterial species

    • Evolutionary analysis to understand specialization of phosphatase function

    • Exploitation of species-specific features for targeted antimicrobial development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.