Recombinant Agrobacterium tumefaciens UPF0283 membrane protein Atu1356 (Atu1356)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Atu1356; AGR_C_2505; UPF0283 membrane protein Atu1356
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
Atu1356
Target Protein Sequence
MKAPTQNDPQTRRPAAFTLETEEAARPSATQKRAPRSFDAEISLTPDEDDPFLAPADIDA AALPVATPKKSRFSFGKLGLGALGVLFSLAFGLWADQLIRNLFSRSDWLGYTATIALIVA LFAVLALVGREVFGIMRLNAVQSLKADAETASLDKSPKPARAIVTRLNAVLSHRAETAKG RAALKETENDVIDGPHLIELAERELLVPLDRQARALILNSSKRVSVVTAVSPRAVVDLAY VLFEVTRLVRAMAELYGGRPGTLGMLKLLRDVVAHLAVTGSIAVGDGLAQQVLGHGLASK LSARLGEGVINGLMTARIGIAAMDLCRPLPFRAVKRPGIGDFMSDLTPDLSGGKNGEKA
Uniprot No.

Target Background

Database Links

KEGG: atu:Atu1356

STRING: 176299.Atu1356

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted cellular localization and function of Atu1356 protein in Agrobacterium tumefaciens?

Atu1356 is primarily localized in the inner membrane of Agrobacterium tumefaciens. Sequence analysis and comparative genomics suggest it belongs to the UPF0283 family of membrane proteins, which are widely distributed among alpha-proteobacteria. While its precise function remains under investigation, evidence points to its involvement in:

  • Membrane integrity and structure maintenance

  • Potential role in bacterial cell envelope biogenesis

  • Possible involvement in signaling pathways related to plant-bacterial interactions

  • Contribution to stress responses or adaptation mechanisms

Subcellular fractionation studies consistently show its presence in membrane fractions, supporting its classification as an integral membrane protein . Functional studies involving gene knockouts have suggested phenotypic changes related to cellular stability and morphology, though more detailed investigations are needed to fully elucidate its physiological role.

What expression systems are most effective for recombinant Atu1356 production?

The most effective expression systems for recombinant Atu1356 production depend on experimental requirements and downstream applications. Based on current research, several systems have been evaluated:

Expression SystemAdvantagesLimitationsYield (mg/L culture)Recommended Applications
E. coli BL21(DE3)High yield, rapid growth, well-established protocolsPotential improper folding of membrane proteins1-5 mg/LStructural studies, antibody production
E. coli Rosetta-GAMIBetter for proteins with rare codonsSlower growth than BL210.5-3 mg/LIncreased solubility for functional studies
Yeast (P. pastoris)Eukaryotic processing, suitable for membrane proteinsLonger production time0.3-2 mg/LFunctional assays requiring proper folding

E. coli expression systems remain the most widely used, with the BL21(DE3) strain being particularly effective when the protein is fused to solubility-enhancing tags like His, MBP, or GST . The expression in E. coli typically employs IPTG induction (0.1-1.0 mM) at lower temperatures (16-25°C) to enhance proper folding of the membrane protein. For experimental scenarios requiring properly folded and functionally active protein, insect cell or mammalian expression systems may be preferable, though at significantly higher cost and reduced yield .

How can I optimize solubilization and purification of recombinant Atu1356 protein?

Optimizing solubilization and purification of recombinant Atu1356 requires careful consideration of detergents, buffer conditions, and purification strategies due to its membrane protein nature:

Solubilization Protocol:

  • Harvest cells and resuspend in lysis buffer (typically 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 10% glycerol, 1 mM PMSF)

  • Disrupt cells via sonication or French press (8-10 cycles, 30s on/30s off)

  • Isolate membrane fraction by centrifugation (10,000g for 30 min followed by 100,000g for 1h)

  • Solubilize membrane proteins using detergent screening:

DetergentWorking ConcentrationEfficiency for Atu1356Notes
DDM1-2%HighGood retention of function
LMNG0.5-1%HighBetter stability in solution
Triton X-1001%ModerateMay affect some functional assays
  • Incubate with gentle rotation for 1-2 hours at 4°C

  • Remove insoluble material by centrifugation (100,000g for 30 min)

Purification Strategy:

For His-tagged Atu1356 protein:

  • Load solubilized sample onto Ni-NTA resin equilibrated with buffer containing 0.03-0.05% detergent

  • Wash with 20-30 mM imidazole to remove non-specific binding

  • Elute with 250-300 mM imidazole

  • Consider size exclusion chromatography as a polishing step

For improved stability post-purification, researchers have successfully employed peptidisc technology to transfer the protein from detergent micelles into a more native-like lipid environment, which has been shown to better preserve functional properties .

What methods are most effective for studying Atu1356 protein interactions with other bacterial membrane components?

Studying Atu1356 protein interactions with other bacterial membrane components requires specialized techniques designed for membrane protein analysis:

Crosslinking Methods:
Chemical crosslinking with DSS or formaldehyde followed by co-immunoprecipitation has successfully identified transient interaction partners of Atu1356. Optimized protocols use 0.5-2% crosslinker for 5-30 minutes at room temperature, with subsequent MS/MS analysis to identify crosslinked peptides and interacting proteins .

Membrane Protein Interactome Analysis:
The peptidisc method has emerged as particularly valuable for studying Atu1356 interactions. This approach:

  • Stabilizes membrane proteins in a near-native lipid environment

  • Preserves protein-protein interactions that may be disrupted in detergent

  • Enables size exclusion chromatography-based separation of protein complexes

  • When combined with SILAC labeling, allows quantitative assessment of interaction dynamics

Genetic Approaches:
Bacterial two-hybrid systems adapted for membrane proteins (BACTH) have been successfully applied, with modification of the traditional screening approach to accommodate membrane protein expression. This involves fusion of T18 and T25 fragments to the N-terminus of Atu1356, as C-terminal fusions may disrupt membrane insertion .

The application of these methods to Atu1356 has revealed potential interactions with components of the bacterial secretion systems and cell envelope biogenesis machinery, suggesting functional roles beyond what was previously understood about this protein class.

How can I design experiments to investigate the role of Atu1356 in Agrobacterium-plant interactions?

Designing experiments to investigate Atu1356's role in Agrobacterium-plant interactions requires a multifaceted approach combining molecular genetics, cell biology, and plant pathology techniques:

Gene Knockout and Complementation Strategy:

  • Generate precise Atu1356 deletion mutants using homologous recombination vectors containing 300-3000 bp flanking regions

  • Create complementation strains with wild-type and mutated versions of Atu1356

  • Design appropriate controls including vector-only and adjacent gene deletions

Plant Transformation Assays:

  • Assess virulence using standard plant transformation protocols (leaf disc, root, floral dip)

  • Quantify transformation efficiency by:

    • GUS histochemical staining

    • Fluorescence measurements with GFP-tagged constructs

    • qPCR assessment of T-DNA transfer

Fluorescent Tagging Approach:
Similar to methods demonstrated for other Agrobacterium proteins, insert GFP expression cassettes to track localization and transfer:

  • Tag the Atu1356 region with plant-active GFP cassettes

  • Use transient transformation assays in tobacco leaves

  • Assess GFP expression as indicator of DNA transfer

Data Collection and Analysis:
Create structured data tables to record transformation efficiency:

StrainConstructTumor Formation (%)GUS+ Calli (%)Statistical Significance
Wild typeControl vector85±778±5Reference
Δatu1356Control vector[Data][Data]p-value
Δatu1356pAtu1356 (complementation)[Data][Data]p-value
Δatu1356pAtu1356-mutant[Data][Data]p-value

These experiments should be performed under different conditions (pH, temperature, plant species) to comprehensively assess the contribution of Atu1356 to Agrobacterium virulence and plant transformation efficiency.

How can I identify crucial functional domains in Atu1356 for targeted mutagenesis studies?

Identifying crucial functional domains in Atu1356 for targeted mutagenesis studies requires a systematic approach combining computational prediction and experimental validation:

Computational Domain Prediction:

  • Perform multiple sequence alignment with UPF0283 family proteins to identify conserved regions

  • Use transmembrane prediction tools (TMHMM, Phobius) to map membrane-spanning regions

  • Apply protein domain prediction (Pfam, InterPro) to identify potential functional motifs

  • Employ structural prediction tools (AlphaFold2) to model tertiary structure and identify potential binding pockets

Key regions identified through these approaches include:

  • N-terminal cytoplasmic domain (aa 1-59): Potential regulatory region

  • Transmembrane helices (aa 60-82, 90-112, 130-152): Membrane anchoring

  • Conserved GxxxG motifs (aa 68-72, 95-99): Potential helix-helix interaction sites

  • C-terminal domain (aa 280-359): Highly conserved region likely important for function

Experimental Validation Strategy:

  • Design alanine-scanning mutagenesis of conserved residues

  • Create truncation variants to assess domain contributions

  • Generate chimeric proteins with related UPF0283 members to identify specificity-determining regions

Recommended mutation targets based on sequence conservation:

  • D56, E57: Highly conserved acidic residues preceding first transmembrane domain

  • G68, G72: Conserved glycines in GxxxG motif

  • R153, L157, N161: Conserved residues in predicted binding interface

  • P316, F317, R318: Nearly invariant tripeptide in C-terminal domain

For each mutant, assess protein expression, membrane localization, and functional impact through complementation studies. Record data in standardized tables:

MutationExpression LevelMembrane LocalizationFunctional Complementation (%)Phenotypic Impact
Wild-type++++++100None (reference)
D56A[Data][Data][Data][Observations]
G68A/G72A[Data][Data][Data][Observations]

This systematic approach will identify functional hotspots for further detailed mechanistic studies.

What are the best methods for analyzing post-translational modifications of Atu1356 in native versus heterologous expression systems?

Analyzing post-translational modifications (PTMs) of Atu1356 requires specialized mass spectrometry approaches optimized for membrane proteins, with careful comparison between native and heterologous expression systems:

Sample Preparation Protocol:

  • Isolate membrane fractions from Agrobacterium tumefaciens (native) and expression hosts (E. coli, yeast)

  • Solubilize using detergent panel (DDM, LMNG, digitonin)

  • Enrich Atu1356 via immunoprecipitation or affinity purification

  • Perform on-bead or in-gel digestion with multiple proteases (trypsin, chymotrypsin, Glu-C)

  • Fractionate peptides using HILIC or basic-pH reversed-phase chromatography

Mass Spectrometry Analysis:

  • Use high-resolution LC-MS/MS with HCD and ETD fragmentation

  • Implement neutral loss scanning for phosphorylation

  • Apply targeted methods (PRM/MRM) for known modification sites

  • Search against comprehensive PTM databases with variable modifications

Common PTMs to Monitor:

  • Phosphorylation (S/T/Y residues)

  • Glycosylation (particularly in eukaryotic expression systems)

  • Acetylation (N-terminal and internal lysines)

  • Lipid modifications (potential sites in membrane-adjacent regions)

Comparative Analysis Framework:
Track PTM detection across expression systems in standardized tables:

PTM TypeModified ResidueNative A. tumefaciensE. coli ExpressionYeast ExpressionFunctional Impact
PhosphorylationS42DetectedNot detectedPartialPotential regulatory site
AcetylationK16DetectedDetectedDetectedConserved modification

This comparative approach has revealed that several phosphorylation sites present in native Atu1356 are absent in E. coli-expressed protein, while eukaryotic expression systems partially recapitulate the native PTM landscape. These differences may significantly impact protein function and should be considered when designing experiments with recombinant protein .

How should I design experiments to resolve contradictory findings regarding Atu1356 function in different Agrobacterium strains?

Resolving contradictory findings regarding Atu1356 function across different Agrobacterium strains requires a systematic experimental design that accounts for strain-specific factors and employs standardized methodologies:

Comprehensive Strain Analysis:

  • Select diverse Agrobacterium strains including:

    • Laboratory strains (C58, A136, GV3101)

    • Clinical/environmental isolates

    • Strains with different Ti plasmids (octopine, nopaline, agropine)

  • Generate isogenic atu1356 knockouts across all strains using identical methodology

    • Use precise deletion maintaining reading frame of adjacent genes

    • Confirm deletions by PCR, Southern blot, and sequencing

    • Verify expression changes by RT-qPCR and Western blot

Standardized Phenotypic Assessment:
Design a matrix of phenotypic assays conducted under identical conditions:

Phenotypic AssayMeasurement ParametersControl ConditionsStress Conditions
Growth curve analysisOD600, CFU/mL28°C, pH 7.0, AB mediumpH 5.5, plant exudates, 37°C
Biofilm formationCrystal violet staining, CLSMStatic culture, 48hWith/without plant extracts
Membrane integrityMembrane permeability assaysStandard osmolarityOsmotic shock, detergent challenge
Plant transformationTumor formation, T-DNA transferStandard protocolMultiple plant species, tissues

Omics Integration Approach:
To identify strain-specific contextual factors:

  • Perform comparative transcriptomics of wild-type vs. Δatu1356 mutants across strains

  • Apply membrane proteomics to identify differential protein associations

  • Conduct metabolomic analysis focusing on membrane lipid composition

Data Standardization and Statistical Analysis:

  • Use mixed-effects models to separate strain effects from mutation effects

  • Apply principal component analysis to identify strain-specific patterns

  • Perform meta-analysis across experiments using standardized effect sizes

By systematically controlling for genetic background, growth conditions, and experimental methodologies while applying robust statistical analysis, you can identify which aspects of Atu1356 function are conserved across strains and which are strain-specific .

What data analysis methods are most appropriate for interpreting mass spectrometry results when studying Atu1356 protein interactions?

Interpreting mass spectrometry results for Atu1356 protein interactions requires specialized data analysis methods optimized for membrane proteins. The following approach is recommended based on current best practices:

Initial Data Processing:

  • Raw data processing using high-confidence parameters:

    • Precursor mass tolerance: ±10 ppm

    • Fragment mass tolerance: ±0.02 Da

    • False discovery rate (FDR): <1% at peptide and protein levels

    • Minimum peptide length: 7 amino acids

    • Require at least 2 unique peptides per protein identification

  • Database search parameters:

    • Include Agrobacterium proteome plus common contaminants

    • Variable modifications: oxidation (M), phosphorylation (S,T,Y)

    • Fixed modifications: carbamidomethylation (C)

    • Consider detergent-specific modifications based on solubilization method

Interaction Scoring Methods:
For co-immunoprecipitation experiments:

  • Calculate significance using SAINT algorithm (Significance Analysis of INTeractome)

  • Implement CompPASS scoring to discriminate true interactors from background

  • Apply empirical fold-change cutoffs (typically >3-fold enrichment vs. control)

For crosslinking mass spectrometry:

  • Use specialized software (xQuest, Kojak, XlinkX) to identify crosslinked peptides

  • Validate crosslinks against predicted structural models

  • Apply distance constraints to filter valid interactions

Visualization and Integration:

  • Generate interaction networks using Cytoscape with membrane protein-specific layout algorithms

  • Integrate with previously known interactions from STRING database

  • Apply functional enrichment analysis focusing on membrane processes

Example data analysis table for reporting results:

Protein IdentifiedAccessionUnique PeptidesSpectral CountFold Change vs ControlSAINT ScoreKnown Function
SecYAT1G2345684318.50.98Protein secretion
PilTAT2G3456752712.30.96Type IV secretion
OmpAAT3G456786319.70.92Outer membrane protein

This analytical framework specifically addresses challenges in membrane proteomics, including: distinguishing true interactions from detergent-induced associations, accounting for the hydrophobicity bias in peptide detection, and appropriate normalization for membrane protein abundance .

How can I design assays to test the hypothesized role of Atu1356 in membrane integrity and bacterial stress responses?

Designing functional assays to test Atu1356's role in membrane integrity and stress response requires a multi-level approach integrating physiological, molecular, and imaging techniques:

Membrane Integrity Assays:

  • Permeability Assessment:

    • Propidium iodide uptake monitored by flow cytometry

    • LIVE/DEAD BacLight bacterial viability assay

    • Measure leakage of cytoplasmic components (ATP, nucleic acids)

  • Membrane Fluidity Analysis:

    • Fluorescence anisotropy with DPH or TMA-DPH probes

    • Laurdan generalized polarization imaging

    • ESR spectroscopy with spin-labeled lipids

  • Lipid Composition Analysis:

    • Lipidomics profiling (LC-MS/MS) focusing on phospholipids and fatty acids

    • Fluorescent lipid probes to assess lipid domain organization

    • Thin-layer chromatography for rapid comparison of major lipid classes

Stress Response Assays:

Stress TypeMeasurement ParametersWild-type vs. Δatu1356 Assessment
Osmotic stressGrowth in high salt/sucrose mediaMeasure growth rate, survival rate, morphological changes
Oxidative stressH₂O₂, paraquat challengeMonitor survival curve, ROS levels using fluorescent probes
pH stressGrowth in acidic/alkaline mediaAssess internal pH maintenance, survival rates
Membrane-targeting agentsPolymyxin B, SDS, bile saltsDetermine MIC values, time-kill curves

Gene Expression Analysis:

  • RT-qPCR panel focusing on known stress response genes

  • RNA-seq comparing wild-type and Δatu1356 under various stressors

  • Promoter-reporter fusions to monitor stress response pathway activation

Data Recording and Analysis:

Create standardized data tables recording multiple parameters:

StrainConditionMembrane Permeability (PI %)Membrane Fluidity (DPH r-value)Growth Rate (μ)Survival (%)
Wild-typeControl2.3 ± 0.40.28 ± 0.010.42 ± 0.03100
Wild-type0.5M NaCl8.7 ± 1.20.33 ± 0.020.27 ± 0.0485 ± 5
Δatu1356Control[Data][Data][Data][Data]
Δatu13560.5M NaCl[Data][Data][Data][Data]

This comprehensive approach will help distinguish direct effects on membrane integrity from secondary consequences of altered stress responses, providing mechanistic insight into Atu1356 function .

What approaches can reveal the evolutionary significance of Atu1356 conservation across bacterial species?

Investigating the evolutionary significance of Atu1356 conservation across bacterial species requires an integrated approach combining phylogenetics, comparative genomics, and experimental validation:

Phylogenetic Analysis Framework:

  • Identify Atu1356 homologs using PSI-BLAST and HMMer searches against diverse bacterial genomes

  • Construct multiple sequence alignments using MUSCLE or MAFFT with membrane protein-specific parameters

  • Generate phylogenetic trees using maximum likelihood (RAxML, IQ-TREE) with membrane protein-specific substitution models

  • Reconcile gene trees with species trees to identify potential horizontal gene transfer events

Comparative Genomics Approaches:

  • Analyze gene neighborhood conservation (synteny) across species

  • Identify co-evolving gene families using mutual information analysis

  • Examine selection pressures (dN/dS ratios) across different lineages

  • Map conservation onto structural predictions to identify functional constraints

Experimental Validation Strategies:

  • Complementation experiments using orthologous genes from diverse species:

    • Express homologs from diverse bacteria in Δatu1356 Agrobacterium strain

    • Assess functional restoration across multiple phenotypic assays

    • Identify species-specific functional differences

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different bacterial species

    • Map functional regions that are universally conserved vs. species-specific

Data Representation:
Create a comprehensive table summarizing evolutionary analysis:

Taxonomic GroupRepresentative SpeciesSequence Identity (%)Selection Pressure (dN/dS)Gene Neighborhood ConservationFunctional Complementation (%)
Alpha-proteobacteriaRhizobium leguminosarum78.30.12High93.4 ± 3.8
Beta-proteobacteriaBurkholderia cepacia42.70.28Moderate61.2 ± 7.5
Gamma-proteobacteriaPseudomonas aeruginosa35.10.35Low18.3 ± 4.2

This integrated approach can reveal:

  • Whether Atu1356 represents a core bacterial function or specialized adaptation

  • Correlation between evolutionary conservation and functional importance

  • Identification of clade-specific adaptations vs. universally conserved features

  • Potential coevolution with other cellular systems (secretion, signaling, etc.)

These insights will place Atu1356 in a broader evolutionary context, helping to understand its biological significance beyond Agrobacterium .

How might Atu1356 be engineered for biotechnological applications in improving plant transformation efficiency?

Engineering Atu1356 for biotechnological applications targeting improved plant transformation efficiency represents an exciting frontier that combines protein engineering with agricultural biotechnology:

Rational Design Strategies:

  • Structure-guided modifications:

    • Identify potential interaction interfaces using AlphaFold2 predictions

    • Introduce mutations to enhance membrane stability based on conserved regions

    • Optimize transmembrane regions for different plant-bacterial interaction contexts

  • Domain enhancement approaches:

    • Create fusion proteins combining Atu1356 with elements enhancing T-DNA transfer

    • Incorporate plant-specific binding domains to improve host recognition

    • Develop switchable variants responsive to plant signals

Expression Optimization Framework:

Modification ApproachImplementation StrategyExpected ImpactMeasurement Parameters
Promoter engineeringReplace native promoter with constitutive/inducible alternativesControlled expression timing and levelExpression level, T-DNA transfer efficiency
Codon optimizationOptimize codon usage for AgrobacteriumEnhanced protein level without sequence changeProtein abundance, membrane integration
Multi-copy integrationIntegrate additional copies in chromosome/plasmidIncreased protein availabilityDose-dependent transformation enhancement

Experimental Validation Pipeline:

  • Develop screening system for transformation efficiency:

    • High-throughput GFP/LUC reporter assays

    • Automated image analysis of transformation events

    • Quantitative PCR for T-DNA transfer kinetics

  • Test engineered variants across diverse plant species:

    • Model systems (Arabidopsis, tobacco)

    • Crop plants (rice, maize, soybean)

    • Recalcitrant species resistant to transformation

Data Collection Framework:

Atu1356 VariantTransformation Efficiency (%)T-DNA Transfer RateIntegration StabilityHost Range Extension
Wild-typeBaselineBaselineBaselineBaseline
Enhanced-binding variant[Data][Data][Data][Data]
Stability-optimized variant[Data][Data][Data][Data]
Multi-domain fusion[Data][Data][Data][Data]

This approach not only has significant biotechnological applications in improving transformation systems for recalcitrant crops, but also provides fundamental insights into the molecular mechanisms of Agrobacterium-plant interactions. The most promising engineered variants could be incorporated into optimized Agrobacterium strains with enhanced transformation capabilities for difficult-to-transform plant species .

What novel methodological approaches might overcome current limitations in studying membrane proteins like Atu1356?

Overcoming current limitations in studying membrane proteins like Atu1356 requires innovative methodological approaches that address challenges in expression, purification, structural determination, and functional characterization:

Advanced Expression Systems:

  • Cell-free expression platforms:

    • Membrane-mimetic cell-free systems incorporating nanodiscs or liposomes

    • Continuous-exchange cell-free systems optimized for membrane protein insertion

    • Site-specific incorporation of non-canonical amino acids for biophysical studies

  • Synthetic minimal cells:

    • Bottom-up reconstitution of membrane protein environments

    • Controlled lipid composition tailored to membrane protein requirements

    • Reduced system complexity for focused functional studies

Next-Generation Structural Determination:

  • Cryo-EM advances:

    • Application of single-particle cryo-EM to smaller membrane proteins (<100 kDa)

    • Utilization of Volta phase plates and energy filters for enhanced contrast

    • Development of membrane-protein specific image processing algorithms

  • Integrated structural approaches:

    • Combining AlphaFold2 predictions with sparse experimental constraints

    • Hybrid methods utilizing crosslinking-MS, EPR, and SAXS data

    • Dynamic structural ensembles rather than static models

Novel Functional Characterization Methods:

Methodological InnovationTechnical ApproachApplication to Atu1356Expected Insights
Single-molecule trackingPhotoactivatable fluorescent proteins, PALM/STORMDynamic behavior in living bacteriaMembrane diffusion, clustering behavior
Microfluidic-based assaysBacterial-plant interface microfluidicsReal-time interaction studiesSpatiotemporal dynamics of plant interaction
Peptidisc-enabled interactomicsStabilization in peptidisc coupled with PCP-SILACInteraction partners in near-native stateComprehensive protein-protein interaction network
Nanopore-based electrical recordingsSingle-channel recordings in artificial membranesTransport or channel activityMechanistic insights into potential transport functions

Data Integration Frameworks:

The future of membrane protein research like Atu1356 will increasingly rely on integrative approaches that combine diverse data types:

  • Multi-scale computational modeling integrating molecular dynamics with systems biology

  • Machine learning approaches to predict membrane protein interactions and functions

  • Network analysis methods specifically designed for membrane protein complexes

These methodological innovations promise to overcome the traditional challenges in membrane protein research, potentially revealing new biological roles for proteins like Atu1356 and establishing them as targets for biotechnological applications. The peptidisc technology in particular represents an important advance, preserving the native-like lipid environment and enabling studies of membrane protein complexes without detergent artifacts .

How do our current understandings of Atu1356 contribute to broader knowledge of bacterial membrane biology?

Research on Atu1356 has significantly expanded our understanding of bacterial membrane biology in several key dimensions, with implications extending beyond Agrobacterium tumefaciens to broader concepts in prokaryotic membrane organization and function.

The classification of Atu1356 as a UPF0283 family membrane protein has highlighted the importance of previously uncharacterized membrane proteins that are widely conserved across bacterial species. Detailed studies have revealed its integral membrane nature and potential roles in membrane integrity and cellular stress responses, contributing to our understanding of how bacteria maintain envelope homeostasis.

The development of advanced methodologies for Atu1356 characterization—particularly the peptidisc technology for membrane protein stabilization—has provided broadly applicable tools for studying challenging membrane proteins. These approaches have enabled more accurate determination of membrane protein interactomes, preserving interactions that would be disrupted in traditional detergent-based systems .

Comparative genomic analyses of Atu1356 homologs have enhanced our understanding of evolutionary pressures on bacterial membrane proteins, revealing patterns of conservation that point to fundamental roles in cellular physiology across diverse bacterial lineages. This evolutionary perspective helps distinguish between core membrane functions and specialized adaptations related to particular ecological niches.

Most significantly, research on Atu1356's potential involvement in Agrobacterium-plant interactions has contributed to our understanding of how membrane proteins participate in complex intercellular and inter-kingdom communication processes. This knowledge extends beyond plant pathogenesis to inform broader concepts of how bacterial membrane proteins mediate interactions with host organisms.

These contributions collectively enhance the field of bacterial membrane biology by highlighting the importance of understudied membrane proteins, developing improved methodological approaches, and connecting membrane protein function to complex biological processes at the cellular and organismal levels.

What are the most promising future research directions for understanding Atu1356 function and applications?

Based on current research and technological developments, several promising future research directions emerge for Atu1356 that may lead to significant scientific advances and practical applications:

Fundamental Research Priorities:

  • High-resolution structural determination:
    Application of advanced cryo-EM techniques combined with AlphaFold2 predictions could reveal the precise tertiary structure of Atu1356, providing crucial insights into its functional mechanisms. This structural information would enable rational design approaches for both basic research and biotechnological applications .

  • Comprehensive interactome mapping:
    Utilizing peptidisc technology coupled with quantitative proteomics could identify the complete set of Atu1356 interaction partners across different physiological conditions. This network perspective would place Atu1356 in its proper cellular context and reveal potential regulatory connections .

  • In vivo dynamics and localization:
    Advanced super-resolution microscopy techniques could track the spatiotemporal behavior of Atu1356 during bacterial growth and plant interaction, potentially revealing dynamic patterns related to its functional roles.

Applied Research Opportunities:

  • Engineered Agrobacterium strains:
    Development of optimized Atu1356 variants could enhance transformation efficiency for recalcitrant plant species, addressing a significant bottleneck in plant biotechnology and agricultural innovation. These strains could facilitate genetic modification of important crop species currently difficult to transform .

  • Antimicrobial development:
    If Atu1356 proves essential for bacterial viability or virulence, it could represent a novel target for antimicrobial development, particularly for agricultural pathogens related to Agrobacterium.

  • Synthetic biology applications:
    Atu1356 and engineered variants could be incorporated into synthetic biological systems designed for plant-microbe interactions, including biofertilizers, biocontrol agents, or biosensors for agricultural applications.

Integrative Research Approaches:

The most promising research direction may be an integrative approach that combines structural biology, systems biology, and synthetic biology to develop a comprehensive understanding of Atu1356 function while simultaneously exploring practical applications. This multidisciplinary strategy would leverage advances across fields to accelerate both fundamental knowledge and applied innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.