Recombinant Agrobacterium tumefaciens UPF0314 protein Atu8092 (Atu8092)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Atu8092; AGR_C_4880; Atu2691.1; UPF0314 protein Atu8092
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58))
Target Names
Atu8092
Target Protein Sequence
MTVAEMSASRSRSLRWFGVAAGLLLLQIVILYAMGRIPICECGYVKLFEPGVNTPGNSQH
LADWYTPSHIIHGFLFYWFAWLLFRNKPFSMRLSFAVLIEAAWELLENSPIIIDRYRTAT
TALGYTGDSILNSAMDTVFMALGFLFAARVPVWLTVVIAIFFEIFTGWLIRDNLTLNVVM
LVWPVDVIKEWQNALPQM
Uniprot No.
Target Background
Database Links
KEGG: atu:Atu8092
STRING: 176299.Atu8092
Protein Families
UPF0314 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
