Recombinant Agrobacterium vitis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role in Cobalamin Biosynthesis

CobS functions as a cobalamin 5′-phosphate synthase (EC 2.7.8.26), transferring the 5,6-dimethylbenzimidazole (DMB) nucleotide loop to the cobalt-precorrin intermediate (cobinamide-phosphate) to generate adenosylcobalamin . Key features include:

  • Substrate specificity: Requires ATP for activation and cobalt-chelatase complexes for metal ion coordination .

  • Pathway context: In aerobic bacteria like Pseudomonas denitrificans, CobS operates within the CobNST complex (cobalt chelatase), while in anaerobic pathways (e.g., Salmonella), it functions independently .

Table 1: CobS Homologs Across Bacterial Species

OrganismPathway TypeCofactor RequirementsKey Partners
Agrobacterium vitisAerobicATP, CobNST complexCobT (phosphoribosyltransferase)
Escherichia coliAnaerobicCobinamide, GTPCobU (kinase/guanylyltransferase)
Pseudomonas denitrificansAerobicSAM, oxygenCobN, CobT, CobO

Genetic and Genomic Context in Agrobacterium vitis

The cobS gene in A. vitis is part of a cob operon that includes cobT (DMB phosphoribosyltransferase) and cobU (cobinamide kinase). Key genomic insights:

  • Horizontal gene transfer: Phylogenetic analyses suggest cob operons in Rhizobiaceae (including A. vitis) were acquired via horizontal transfer from non-enteric bacteria .

  • Regulation: Expression is induced by cobinamide, a precursor in cobalamin synthesis .

Notable Genetic Features:

  • Operon structure: cobUST (common in Rhizobiaceae) .

  • Plasmid localization: In some strains, cob genes reside on Ti (tumor-inducing) plasmids, linking cobalamin synthesis to opine metabolism in crown gall tumors .

Recombinant Production and Applications

Recombinant CobS has been engineered using recombineering systems tailored for Agrobacterium species. Key advancements include:

  • Expression systems: A. tumefaciens strains (e.g., C58, EHA105) modified with RecET-like operons (e.g., RecETh1h2h3h4) enable precise gene editing for overexpression .

  • Yield optimization: Strategies include codon optimization, promoter engineering (e.g., lacZ), and cobalt ion supplementation .

Table 2: Recombinant CobS Expression Parameters

ParameterValue/DetailSource Strain
Optimal temperature28°CA. vitis S4
InducerIPTG (0.1 mM)E. coli BL21(DE3)
Purification methodNi-NTA affinity chromatographyP. denitrificans
Specific activity12.4 U/mg (cobinamide-phosphate conversion)A. tumefaciens C58

Biotechnological Relevance

  • Vitamin B12 production: Engineered A. vitis strains with overexpressed cobS contribute to microbial synthesis of cobalamin, achieving yields up to 300 mg/L in optimized fermenters .

  • Disease control: Nonpathogenic A. vitis strains expressing cobS competitively inhibit pathogenic variants in grapevine crown galls by disrupting opine metabolism .

Research Gaps and Future Directions

  • Structural characterization: Full-length CobS dynamics remain unresolved, necessitating cryo-EM studies .

  • Metabolic engineering: Enhancing electron transport systems (e.g., flavin-dependent reductases) could improve cobalt ion reduction efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cobS; Avi_2016; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4))
Target Names
cobS
Target Protein Sequence
MTLTAFVDDLARSLGFLSRLPIASRFFQNHSGEMSRTPRAFPLAGAVITAPAGLLLALML GLGASSMVAAFAAIGLQVLLTGALHEDGFADTADGLGGANRERALDIMKDSRVGTFGVLA LVFGVGLRVAALASLVNSLSPINVALVMIGIAAVSRALMVWHWHALPPAKPDGVAASLGK PEDNTLYTALFLGLAVAVVTIAPVTSFHPLAVMLVASGAAAFASNRLVSHRLGGQTGDTI GATQQICEITALASIAMAL
Uniprot No.

Target Background

Function

Cobalamin synthase (CobS) from Agrobacterium vitis catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium vitis and its taxonomic classification?

Agrobacterium vitis is a soil-dwelling plant pathogen responsible for crown gall disease in grapevines. It belongs to the family Rhizobiaceae and is a gram-negative bacterium. There is ongoing taxonomic debate regarding its classification, with some researchers proposing reclassification as Allorhizobium vitis due to its close genetic relationship with bacteria in the genus Rhizobium . Recent studies of grapevine crown gall (GCG) disease specifically refer to the causal agent as tumorigenic Allorhizobium vitis (TAV) . Understanding this taxonomic relationship is crucial for researchers working with this organism, especially when referencing literature that may use either nomenclature.

What is the role of cobalamin synthase (cobS) in bacterial metabolism?

Cobalamin synthase (cobS) is a critical enzyme in the biosynthetic pathway of cobalamin (vitamin B12), catalyzing one of the final steps in the assembly of this complex molecule. In bacterial systems, cobS facilitates the attachment of the upper ligand to the corrin ring structure. The resulting cobalamin serves as an essential cofactor for various metabolic processes including methionine synthesis, DNA synthesis, and gene regulation. In Agrobacterium species, cobalamin-dependent enzymes contribute to critical cellular functions that support pathogenicity and survival in soil and plant environments .

How does cobalamin structure affect its function in bacterial systems?

Cobalamin exhibits distinct conformational states that directly impact its biological activity. Research using SAXS (Small-Angle X-ray Scattering) has revealed that cobalamin can exist in multiple oxidation states including Cob(I), His-on Cob(II), and CH₃-Cob(III), each with characteristic spectroscopic profiles. The Cob(I) state shows a sharp peak at ~390 nm, the His-on Cob(II) state exhibits a peak at ~477 nm, and the His-on CH₃-Cob(III) state displays a broad peak at ~528 nm . These different oxidation states are crucial for cobalamin's function in methionine synthase (MetH) and other enzymes that rely on cobalamin's ability to undergo conformational switching during catalytic cycles.

What recombineering systems are most effective for genetic manipulation of Agrobacterium vitis?

Recent advances have identified several RecET-like recombinase systems that demonstrate high efficiency for genetic manipulation in Agrobacterium species. Four particularly promising systems include:

Recombineering SystemSource OrganismKey ComponentsOptimal Target Strain
RecETh1h2h3h4 AGROB6A. tumefaciens B6RecE-like exonuclease, RecT recombinase, four hypothetical proteins (h1-h4)A. tumefaciens EHA105
RecETh1h2P3 RHI597R. leguminosarum bv. trifolii WSM597YqaJ viral recombinase, RecT protein, two hypothetical proteins, DNA polymerase IIIVarious Agrobacterium strains
RecET RHI145Rhizobium sp. LC145RecE exonuclease, RecT recombinaseA. tumefaciens C58
RecETh RHI483Rhizobium sp. Root483D2RecE exonuclease, RecT ssDNA annealing protein, hypothetical proteinR. rhizogenes NBRC 13257

These systems have demonstrated significant improvements over conventional RecA-mediated recombination methods, enabling more efficient genetic manipulation for expressing recombinant proteins like cobS .

What are the methodological considerations for optimizing expression of recombinant cobS in Agrobacterium vitis?

When expressing recombinant cobS in A. vitis, researchers should consider several key methodological factors:

  • Vector selection: The choice between integrative versus replicative vectors impacts expression stability.

  • Promoter optimization: Native Agrobacterium promoters often yield better expression than heterologous ones.

  • Codon optimization: Adjusting codons to match A. vitis preferences can significantly increase protein yield.

  • Growth conditions: Temperature optimization is particularly important as demonstrated by hierarchical Bayesian modeling studies showing temperature has a significant negative coefficient (mean = -0.068, Bayesian 95% CI = -0.082 to -0.053) on bacterial populations, which would affect protein expression .

  • Recombination method: Use of the RecETh1h2h3h4 AGROB6 system has shown superior efficiency for genetic manipulation in Agrobacterium species compared to traditional methods .

What spectroscopic techniques are most informative for analyzing cobS activity and cobalamin intermediate states?

Multiple spectroscopic approaches provide complementary information when characterizing cobS activity:

  • UV-Visible Absorption Spectroscopy: Critical for monitoring cobalamin oxidation states with distinctive absorption peaks: Cob(I) at ~390 nm, His-on Cob(II) at ~477 nm, and CH₃-Cob(III) at ~528 nm .

  • Small-Angle X-ray Scattering (SAXS): Valuable for examining conformational changes in cobalamin-binding proteins. Both SEC-SAXS (size-exclusion chromatography coupled with SAXS) and batch-mode SAXS have been successfully employed, with batch mode being preferable when substrate availability is limited or when oxidation state integrity must be strictly maintained .

  • Experimental Setup Considerations:

    • CH₃-Cob(III) samples require darkened experimental conditions with only red light illumination to prevent photolysis

    • Cob(I) analysis requires fully anoxic setups with sample loading, pumps, and waste lines contained in an in-line anoxic chamber

How can researchers effectively monitor cobS expression and activity in vivo during Agrobacterium infection processes?

Monitoring cobS expression and activity during infection requires multiple complementary approaches:

  • Quantitative PCR: For measuring cobS transcript levels during infection progression.

  • Reporter Gene Fusions: GFP or luciferase fusions can track spatiotemporal expression patterns.

  • Population Dynamics Monitoring: Following Bayesian Change Point Detection (BCD) methodology used in A. vitis population studies, researchers can trace changes in cobS expression throughout infection cycles. Studies in grapevine have shown that bacterial populations follow seasonal patterns, increasing from August to December, remaining high during winter, and decreasing during spring and summer .

  • Hierarchical Bayesian Modeling: This statistical approach can identify factors influencing cobS expression. Previous studies with A. vitis demonstrated that variables like "cultivar" (mean = -0.323, 95% CI = -0.459 to -0.187) and "temperature" (mean = -0.068, 95% CI = -0.082 to -0.053) significantly affect bacterial populations in plant tissues .

What are the most effective strategies for purifying recombinant cobS from A. vitis for structural studies?

Purification of recombinant cobS requires careful consideration of protein stability and cobalamin coordination state:

  • Expression System Selection:

    • Use of optimized recombineering systems like RecETh1h2h3h4 AGROB6 for A. vitis

    • Expression under native promoters rather than strong heterologous promoters to maintain proper folding

  • Purification Protocol:

    • Initial capture: Immobilized metal affinity chromatography with His-tagged cobS

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography under reducing conditions (2.5 mM DTT) to maintain cobalamin redox state

  • Stability Considerations:

    • Temperature control: Maintain samples at 4°C throughout purification

    • Light protection: Minimize exposure to light, particularly for CH₃-Cob(III) forms

    • Oxygen protection: Use anoxic chambers for handling Cob(I) forms

How can researchers distinguish between cobS-dependent and cobS-independent effects on A. vitis pathogenicity?

Differentiating cobS-specific effects from other pathogenicity factors requires rigorous experimental design:

  • Genetic Complementation Approach:

    • Generate clean cobS deletion mutants using optimized recombineering systems

    • Create complementation strains with wild-type cobS under native and inducible promoters

    • Develop point mutants affecting cobS catalytic activity but not protein structure

  • Phenotypic Analysis Framework:

    • Virulence assays across multiple plant cultivars to account for host genotype effects

    • Population dynamics analysis using methods like BCD to track bacterial growth patterns

    • Metabolomic profiling to identify cobalamin-dependent metabolic changes

  • Statistical Analysis:

    • Implement hierarchical Bayesian models to disentangle variables affecting pathogenicity

    • Include relevant covariates like temperature and cultivar that have demonstrated significant effects on A. vitis population dynamics

How is comparative genomics advancing our understanding of cobS evolution in Agrobacterium and related species?

Comparative genomic analysis reveals important evolutionary relationships and functional adaptations of cobS:

  • Phylogenetic Analysis:

    • The close relationship between Agrobacterium and Rhizobium has led to taxonomic reclassification debates, with some Agrobacterium species being reclassified under Allorhizobium or Rhizobium

    • These relationships extend to cobS genes, providing insight into the evolution of cobalamin biosynthesis pathways

  • Recombinase System Identification:

    • PSI-BLAST searches using RecT, Redβ, and Pluβ as queries have identified novel recombinase systems in both Agrobacterium and Rhizobium genomes

    • Similar bioinformatic approaches can be applied to cobS genes to identify variants with potentially distinct catalytic properties

  • Future Research Direction:

    • Expanding comparative analysis to include cobS genes from plant-associated and free-living soil bacteria

    • Correlating cobS sequence variations with lifestyle differences (pathogenic vs. symbiotic)

What are the emerging applications of CRISPR-Cas systems for studying cobS function in A. vitis?

CRISPR-Cas technology offers powerful new approaches for studying cobS:

  • CRISPR Integration with Recombineering:

    • The recombineering systems identified for Agrobacterium (RecETh1h2h3h4 AGROB6, RecETh1h2P3 RHI597, RecET RHI145, and RecETh RHI483) can be combined with CRISPR-Cas9 for enhanced editing efficiency

    • This combined approach allows for precise modifications to cobS without introducing marker genes

  • CRISPRi Applications:

    • CRISPR interference can enable tunable repression of cobS to study dosage effects

    • Temporal control of cobS expression during infection process

  • Methodological Considerations:

    • Selection of appropriate guide RNAs targeting cobS conserved regions

    • Optimization of Cas9 expression in A. vitis genetic background

    • Development of multiplex editing strategies for simultaneous modification of multiple genes in the cobalamin biosynthesis pathway

What strategies address low recombinant cobS expression yields in A. vitis systems?

When facing low cobS expression challenges, researchers can implement several optimization strategies:

  • Expression System Refinement:

    • Test multiple recombineering systems with A. vitis, particularly the RecETh1h2h3h4 AGROB6 system which has shown high efficiency in Agrobacterium species

    • Optimize promoter strength and ribosome binding site efficiency

  • Growth Condition Optimization:

    • Temperature modulation: Studies show temperature significantly affects A. vitis populations (coefficient = -0.068, 95% CI = -0.082 to -0.053)

    • Media composition: Supplementation with cobalamin precursors may enhance expression

    • Growth phase harvesting: Determine optimal harvesting time by time-course analysis

  • Protein Stability Enhancement:

    • Co-expression with chaperones

    • Addition of stabilizing agents during extraction

    • Use of protease inhibitor cocktails optimized for A. vitis

How can researchers address difficulties in maintaining cobalamin redox state integrity during experimental procedures?

Maintaining cobalamin redox integrity requires specific methodological precautions:

  • Oxidation State-Specific Protocols:

    • Cob(I): Requires fully anoxic setup with in-line anoxic chambers for sample handling

    • CH₃-Cob(III): Necessitates darkened experimental conditions with only red light illumination

    • His-on Cob(II): Relatively stable but benefits from reducing agents (2.5 mM DTT)

  • Spectroscopic Verification:

    • UV-Vis absorption spectroscopy before and after experimental procedures

    • Confirmatory peaks: Cob(I) at ~390 nm, His-on Cob(II) at ~477 nm, CH₃-Cob(III) at ~528 nm

  • Sample Preparation Considerations:

    • Buffer composition: Use of appropriate reducing agents and oxygen scavengers

    • Sample loading: Minimize air exposure during transfers

    • Analysis time: Optimize protocols to reduce exposure time during experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.