Recombinant Agrobacterium vitis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Avi_3171; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4))
Target Names
lgt
Target Protein Sequence
MNTVASLFAILPYPQIDPIALSIGPVAIRWYGLAYVTGILIGWWLARRMIANLSLWPGNT TPITEKHLDDFLVWAAIGIVLGGRIGYILFYDLQPVLDNPLVALEIWRGGMSFHGGLTGA TLAMIVFARRNGLPVWMLFDLVACVAPIGLFFGRIANFINGELWGRVSDVAWAMQFPTGG PFTRHPSQLYEAALEGLVLFVLLQVLARQFHALKTSGVISGVFICGYALARIFVEFFREP DEQLGYLVGGWLTMGMLLSLPMLALGLWAIWRARRAGRSQEPSGLKG
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, representing the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium vitis and what role does it play in plant pathology?

Agrobacterium vitis is a phytopathogenic bacterium that causes crown gall disease in grapevines. This Gram-negative bacterium can be identified through PCR-based screening using specific primers that target the 16S rRNA gene and species-specific RecA sequences. For species-level identification, researchers typically use RecA primers F8360 (5′-AGC TCG GTT CCA ATG AAA-3′) and F8361 (5′-GCT TGC GCA GCG CCT GGC T-3′) which are specific for A. vitis . The pathogen forms crown galls on grapevine stems approximately 60 days after infection, with severity varying across different Vitis species . Research has demonstrated that grapevine species can be classified into three response categories based on resistance: RR (resistant), SR (moderately resistant), and SS (susceptible) .

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what function does it serve in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical bacterial enzyme that catalyzes the first step in the biogenesis of Gram-negative bacterial lipoproteins. This process is essential for bacterial growth and pathogenesis. Specifically, Lgt catalyzes the attachment of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine (+1 position) in the prolipoprotein via a thioether bond . This modification occurs after preprolipoproteins are secreted through the inner membrane via the Sec or Tat pathways. The preprolipoproteins contain a signal peptide followed by a conserved four amino acid sequence, [LVI][ASTVI][GAS]C, known as a lipobox. The activity of Lgt is fundamental to bacterial membrane integrity, and its inhibition leads to significant disruptions in outer membrane structure and function .

How does the lipoprotein biosynthesis pathway function in Gram-negative bacteria like Agrobacterium vitis?

In Gram-negative bacteria, lipoprotein biosynthesis involves a sequential three-enzyme pathway localized at the inner membrane:

  • Lipoprotein diacylglyceryl transferase (Lgt): Catalyzes the attachment of diacylglyceryl from phosphatidylglycerol to the thiol group of the conserved cysteine in the lipobox via a thioether bond .

  • Prolipoprotein signal peptidase (LspA): An aspartyl endopeptidase that cleaves the signal peptide N-terminal to the conserved diacylated +1 cysteine .

  • Lipoprotein N-acyl transferase (Lnt): Adds a third acyl chain to the amino group of the N-terminal cysteine via an amide linkage .

After complete processing, mature triacylated lipoproteins destined for the outer membrane are extracted from the inner membrane by the LolCDE ATP-binding cassette transporter and transported to the outer membrane via periplasmic chaperone protein LolA and outer membrane lipoprotein LolB . This pathway is critical for bacterial viability, making its components potential targets for antimicrobial development.

What PCR-based methods are used for identification and characterization of Agrobacterium vitis strains?

Researchers employ a multi-target PCR approach for comprehensive identification and characterization of Agrobacterium vitis:

  • 16S rRNA gene amplification: Using either primer pairs 27F (5′-AGR GTT YGA TYM TGG CTG AG-3′) and 1492R (5′-GGY TAC CTT GTT ACG ACT T-3′), or 515F (5′-GTG YCA GCM GCC GCG GTA A-3′) and 806R (5′-GGA CTA CNV GGG TWT CTA AT-3′) for genus-level identification .

  • RecA gene fragment amplification: Using A. vitis-specific primers F8360 (5′-AGC TCG GTT CCA ATG AAA-3′) and F8361 (5′-GCT TGC GCA GCG CCT GGC T-3′) to differentiate A. vitis from other Agrobacterium species .

  • VirD2 fragment amplification: This identifies the presence of the Ti (Tumor-inducing) plasmid, which contains virulence genes essential for plant infection and crown gall formation .

These PCR methods can be performed using colonies with Agrobacterium-like morphology subcultured on selective media such as YEB-CHX or LB-CHX agar plates, providing a comprehensive identification protocol for research and diagnostic purposes.

How can Lgt enzymatic activity be measured in vitro for functional characterization studies?

The enzymatic activity of Lgt can be measured in vitro using a coupled luciferase reaction that detects glycerol phosphate released during the diacylglyceryl transfer reaction. The assay protocol involves:

  • Using a peptide substrate derived from the Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine modified by Lgt) .

  • Measuring the release of glycerol phosphate, a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to the peptide substrate .

  • When using phosphatidylglycerol substrate with a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released as Lgt catalyzes the reaction .

  • G3P detection involves a coupled luciferase reaction for quantification of enzymatic activity .

A control using mutant Pal peptide substrate (Pal-IAAA), where the conserved cysteine is mutated to alanine, can be employed to verify assay specificity, as this substrate should not be recognized by Lgt . This biochemical assay provides a quantitative method for measuring Lgt activity and evaluating potential inhibitors, with potent inhibitors showing IC50 values in the sub-micromolar range (e.g., G9066: 0.24 μM, G2823: 0.93 μM, and G2824: 0.18 μM) .

What are the consequences of Lgt inhibition or depletion in bacterial systems, and how can these effects be experimentally validated?

Lgt inhibition or depletion leads to several significant phenotypes in bacterial systems:

  • Outer membrane permeabilization: Depletion of Lgt in uropathogenic Escherichia coli results in compromised outer membrane integrity, leading to increased permeability .

  • Increased antibiotic susceptibility: Lgt-depleted bacteria show enhanced sensitivity to antibiotics, particularly those normally excluded by the intact outer membrane .

  • Increased serum sensitivity: Loss of Lgt function renders bacteria more vulnerable to complement-mediated killing in serum .

These effects can be experimentally validated through:

  • Western blot analysis: Detecting accumulation of prolipoprotein intermediates, particularly pro-Lpp (the substrate of Lgt), using SDS fractionation to separate peptidoglycan-associated proteins (PAP) and non-PAP fractions .

  • Membrane permeability assays: Using fluorescent dyes like propidium iodide that only enter cells with compromised membranes.

  • Antibiotic susceptibility testing: Comparing minimum inhibitory concentrations (MICs) between wild-type and Lgt-depleted strains.

  • Serum resistance assays: Exposing bacteria to serum and monitoring survival rates over time.

Unlike inhibition of other lipoprotein biosynthesis steps, deletion of the major outer membrane lipoprotein (lpp) does not rescue growth after Lgt depletion, suggesting distinct mechanisms of cell death when Lgt function is compromised .

What metabolomic approaches can be used to identify compounds associated with resistance or susceptibility to A. vitis infection?

Metabolomic analysis of A. vitis infection employs several sophisticated approaches:

  • Gas chromatography-mass spectrometry (GC-MS): This technique has successfully identified 134 metabolites in various compound classes associated with A. vitis infection in grapevines . Sample preparation involves careful tissue collection at various time points (pre-inoculation and post-inoculation stages).

  • Multivariate statistical analysis: Principal component analysis (PCA) can be used to identify clustering patterns among different grapevine species based on their metabolic profiles, revealing distinct groupings according to resistance phenotypes (RR, SR, and SS) .

  • Orthogonal Projections to Latent Structures (OPLS): This statistical method helps identify potential metabolites related to specific resistance types based on Variable Importance in Projection (VIP) scores >1 and P ≤ 0.05 .

  • Fisher's least significant difference (LSD) test: Used for statistical validation of the relationships between specific metabolites and response types .

These approaches have revealed that most disease-related metabolites are induced by pathogen infection rather than being pre-existing, with 8 of 11 significant metabolites detected at two days post-inoculation . Interestingly, metabolites associated with susceptibility (7) outnumber those associated with resistance (3) or moderate resistance (1), suggesting differential metabolic responses that could be exploited for disease management strategies .

What are the structural and functional differences between Lgt from A. vitis and Lgt from other bacterial species?

While the search results don't provide specific structural information about A. vitis Lgt, comparative analysis of Lgt across bacterial species typically focuses on:

Experimental approaches to characterize these differences would include:

  • Homology modeling: Using solved Lgt structures as templates to predict the A. vitis Lgt structure.

  • Recombinant expression and purification: Expressing A. vitis Lgt in E. coli or other expression systems for biochemical and structural studies.

  • Cross-species complementation: Testing whether A. vitis Lgt can complement Lgt-deficient strains of other bacterial species.

  • Comparative biochemical analysis: Assessing substrate specificity, kinetic parameters, and inhibitor sensitivity across Lgt orthologs.

Understanding these differences is crucial for developing species-selective Lgt inhibitors and elucidating the evolutionary conservation of this essential bacterial pathway.

What is the optimal protocol for grapevine inoculation with A. vitis in experimental settings?

Based on established research protocols, optimal A. vitis inoculation of grapevines involves:

  • Plant material preparation:

    • Collect green shoot cuttings from grapevine species

    • Place cuttings in a perlite bed for rooting at 25°C with mist for one month

    • Transfer rooted cuttings to pots with soil for pathogen inoculation

  • Pathogen preparation:

    • Culture A. vitis on potato-dextrose agar (PDA) at 25°C for three days

    • Collect bacterial cultures by scratching the agar surface with sterile distilled water

    • Adjust bacterial concentration to 10^9 colony-forming units (CFU) ml^-1 using dilution plate method

  • Inoculation procedure:

    • Create a wound approximately 1.0 mm deep in the internode of the green shoot using a 2-mm drill

    • Inject 10 μl of bacterial suspension into the wound using a micropipette

    • Immediately wrap the wound site with sealing film (Parafilm)

    • Maintain plants at 25°C in a greenhouse

  • Assessment of infection:

    • Monitor symptom development every other day after inoculation

    • Evaluate gall severity at 60 days post-inoculation based on:

      • Gall incidence (GI): percentage of inoculated sites developing galls

      • Gall diameter (GD): average diameter of developed galls

This protocol enables classification of grapevine responses into resistant (RR), moderately resistant (SR), and susceptible (SS) categories for comparative studies of host-pathogen interactions.

How can researchers effectively analyze metabolite profiles associated with A. vitis infection?

Effective metabolite profiling for A. vitis infection studies requires:

  • Sample collection and preparation:

    • Collect stem tissues at strategic timepoints: pre-inoculation and multiple post-inoculation stages (e.g., 2, 5, and 10 days after inoculation)

    • Flash-freeze samples in liquid nitrogen and grind to a fine powder

    • Extract metabolites using appropriate solvents based on target compound classes

  • Gas chromatography-mass spectrometry (GC-MS) analysis:

    • Derivatize samples if necessary for GC-MS compatibility

    • Use appropriate column and temperature program for separation

    • Employ mass spectrometry for compound identification

  • Data preprocessing:

    • Normalize spectrum peak data using Pareto scaling (division by the square root of the standard deviation of each sample variance)

    • Perform baseline correction and peak alignment

  • Statistical analysis:

    • Conduct Principal Component Analysis (PCA) to identify clustering patterns among samples

    • Apply Orthogonal Projections to Latent Structures (OPLS) analysis

    • Select metabolites based on Variable Importance in Projection (VIP) score > 1 and P ≤ 0.05

    • Group GC-MS data by response types (RR, SR, SS)

    • Perform Fisher's least significant difference (LSD) test based on critical values from t-distribution table at P ≤ 0.05 (two-tailed)

    • Conduct Analysis of Variance (ANOVA) in a completely randomized design

This comprehensive approach allows for robust identification of metabolites associated with different resistance phenotypes, facilitating the development of biomarkers for resistance screening and revealing potential mechanisms underlying grapevine responses to A. vitis infection.

Classification of Grapevine Responses to A. vitis Infection

Response TypeDefinitionGall Incidence (GI)Gall Diameter (GD)Number of SpeciesInterpretation
RRResistantLowSmall4High resistance to infection and gall formation
SRModerately ResistantHighSmall4Susceptible to infection but restricted gall development
SSSusceptibleHighLarge2Highly susceptible to both infection and extensive gall formation

This classification system provides a framework for evaluating grapevine resistance to A. vitis, enabling researchers to categorize genotypes based on quantitative measurements of disease development .

Lgt Inhibitors and Their Activities

InhibitorIC50 (μM)Bactericidal ActivityTarget Validation Method
G90660.24Active against wild-type A. baumannii and E. coliIn vitro enzymatic assay measuring glycerol phosphate release
G28230.93Active against wild-type A. baumannii and E. coliWestern blot detection of accumulated Lpp intermediates
G28240.18Active against wild-type A. baumannii and E. coliPhenotype recapitulation in Lgt-depleted strains

These Lgt inhibitors represent the first described compounds targeting this essential enzyme, validating Lgt as a novel druggable antibacterial target with potential applications against various Gram-negative pathogens .

PCR Primers for Agrobacterium vitis Identification

Target GenePrimer NameSequence (5' to 3')Purpose
16S rRNA27FAGR GTT YGA TYM TGG CTG AGGenus-level identification
16S rRNA1492RGGY TAC CTT GTT ACG ACT TGenus-level identification
16S rRNA515FGTG YCA GCM GCC GCG GTA AGenus-level identification
16S rRNA806RGGA CTA CNV GGG TWT CTA ATGenus-level identification
RecAF8360AGC TCG GTT CCA ATG AAAA. vitis species-specific identification
RecAF8361GCT TGC GCA GCG CCT GGC TA. vitis species-specific identification
VirD2Not specifiedNot specifiedTi plasmid detection

This PCR primer set provides a comprehensive approach for identifying and characterizing Agrobacterium vitis in research and diagnostic applications .

What are the most promising areas for future research on A. vitis Lgt?

Several high-priority research directions emerge from current understanding of A. vitis Lgt:

  • Structural biology approaches: Determining the crystal structure of A. vitis Lgt would provide crucial insights into its catalytic mechanism and facilitate structure-based drug design for selective inhibitors.

  • Development of plant-compatible Lgt inhibitors: Engineering Lgt inhibitors that can be delivered to plants for disease prevention represents a novel approach to crown gall management that targets a fundamental bacterial process.

  • Metabolic engineering of resistant grapevines: Based on metabolomic findings, engineering grapevines to produce elevated levels of resistance-associated metabolites, particularly resveratrol and other stilbene compounds, could enhance natural defense mechanisms .

  • Comparative genomics of Lgt across Agrobacterium species: Investigating sequence and functional conservation of Lgt across various Agrobacterium species could reveal species-specific features that might be exploited for targeted interventions.

  • Development of diagnostic tools: Creating rapid diagnostic methods based on PCR detection of A. vitis-specific genes combined with metabolite biomarkers could improve early detection and management of crown gall disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.