Recombinant Agrobacterium vitis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your needs.
Lead Time
Delivery times may vary based on purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its implementation.
Synonyms
htpX; Avi_4296; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4))
Target Names
htpX
Target Protein Sequence
MNIMRTAMLLAFMTALFMGVGFLIGGKGGMMIALVIAGAMNLFSYWNSDRMVLSAYHAQE VDPRNAPEFYEIVRGLTQNAGLPMPKVYIFDNPQPNAFATGRNPQNAAVAASTGLLQALT PEEVAGVMAHELAHVEHRDTLTMTITATLAGAISMLGNFAFFFGGRRDENGNGGGIIGPL VAMIVAPFAAMLVQMAISRTREYAADRRGAEICGNPLWLASALAKIAGAHQPNYQAERNP ATAHMFIINPLSGQKMDSLFSTHPDTSNRIAALQALAQEMGGRQANVYRPQHSKPAASGP WGSSAERSTDDPWGVKGGASTRSVPKIGRRGKDNDAPKGPWN
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Agrobacterium vitis Protease HtpX homolog and what is its function?

Agrobacterium vitis Protease HtpX homolog (htpX) is a membrane-bound zinc metalloprotease involved in proteolytic quality control of membrane proteins. It shares significant sequence homology with HtpX proteins from other bacterial species, particularly Escherichia coli HtpX, which has been better characterized. The protein functions primarily in stress response mechanisms and participates in the degradation of misfolded or damaged membrane proteins .

The HtpX protein from E. coli, which serves as a model for understanding A. vitis HtpX, has been confirmed to cleave membrane proteins such as SecY and can also degrade soluble proteins like casein in the presence of zinc . The A. vitis HtpX likely performs similar functions in maintaining membrane protein homeostasis during stress conditions.

How does the A. vitis HtpX compare to HtpX homologs in other bacterial species?

A. vitis HtpX shows significant homology to HtpX proteins from other bacteria, particularly those from the Agrobacterium genus and E. coli. When comparing with A. tumefaciens HtpX (321 amino acids), there are notable similarities in sequence and predicted functional domains .

The E. coli HtpX has been more extensively studied and shares key functional characteristics with A. vitis HtpX, including zinc-dependent proteolytic activity. Both proteins accumulate primarily in the periplasm during exponential growth . Computational proteomic studies indicate that HtpX homologs across different bacterial species range from 279 to 336 amino acids in length, sharing conserved residues that are critical for function .

What are the optimal expression systems for producing recombinant A. vitis HtpX?

The most effective expression system documented for recombinant A. vitis HtpX is E. coli. Commercial preparations typically use E. coli expression systems with the full-length protein (1-342 amino acids) fused to an N-terminal His-tag . This approach allows for efficient expression and subsequent purification using affinity chromatography.

When expressing A. vitis HtpX in E. coli, several considerations should be taken into account:

  • Expression vector selection: Vectors with strong inducible promoters like T7 are commonly used

  • E. coli strain: BL21(DE3) or similar strains deficient in certain proteases are recommended

  • Induction conditions: Temperature, inducer concentration, and induction time should be optimized

  • Inclusion body formation: As a membrane protein, HtpX may form inclusion bodies requiring solubilization

Based on studies with E. coli HtpX, which undergoes self-degradation upon cell disruption, it may be necessary to perform purification under denaturing conditions followed by refolding in the presence of zinc chelators to maintain protein integrity .

What purification strategies yield the highest purity and activity for A. vitis HtpX?

Drawing from approaches used with E. coli HtpX, the following purification strategy is recommended for A. vitis HtpX:

  • Initial purification under denaturing conditions using 6-8M urea or guanidine hydrochloride to prevent self-degradation

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Refolding by dialysis in the presence of a zinc chelator such as EDTA

  • Final activation by addition of Zn²⁺ when ready for activity assays

This approach addresses the tendency of HtpX proteases to undergo self-cleavage during purification. Commercial preparations achieve greater than 90% purity as determined by SDS-PAGE analysis . The purified protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with recommendations to add glycerol (5-50% final concentration) for long-term storage at -20°C/-80°C .

How can I confirm the activity of purified recombinant A. vitis HtpX?

Activity confirmation for recombinant A. vitis HtpX can be performed using several approaches based on its known proteolytic function. The following assays are recommended:

  • Self-cleavage assay: Monitoring the self-degradation of purified HtpX after addition of Zn²⁺ using SDS-PAGE

  • Casein degradation assay: Using casein as a substrate and measuring the release of acid-soluble peptides

  • Membrane protein substrate cleavage: Using solubilized SecY or other membrane proteins as substrates

  • Zinc-dependence verification: Comparing activity with and without zinc to confirm metalloprotease function

When performing these assays, it's important to include appropriate controls:

  • Negative control: Heat-inactivated enzyme or samples without zinc

  • Positive control: E. coli HtpX with established activity

  • Substrate controls: Ensuring substrates are not degraded by contaminating proteases

The enzymatic activity should be zinc-dependent, consistent with its classification as a zinc metalloprotease .

How can I use A. vitis HtpX in protein quality control studies?

To utilize A. vitis HtpX in protein quality control studies, researchers should consider the following methodological approaches:

  • Membrane protein stress response models:

    • Express HtpX in bacterial systems under various stress conditions

    • Monitor the degradation of model membrane proteins

    • Compare wild-type and mutant HtpX effects on cell viability during stress

  • In vitro degradation assays:

    • Purify potential substrate proteins (preferably membrane proteins)

    • Incubate with active A. vitis HtpX in the presence of Zn²⁺

    • Analyze degradation products by SDS-PAGE, western blotting, or mass spectrometry

  • Comparative analysis with FtsH protease:

    • Co-express HtpX with FtsH (another membrane-bound protease)

    • Evaluate synergistic or competitive effects on substrate degradation

    • Identify specific roles in quality control mechanisms

These approaches allow for the investigation of HtpX's role in membrane protein quality control and its potential collaboration with other proteolytic systems .

What precautions should be taken when working with recombinant A. vitis HtpX?

Several important precautions should be observed when working with recombinant A. vitis HtpX:

  • Self-degradation prevention:

    • Maintain the protein in the absence of zinc during purification steps

    • Use protease inhibitors during cell lysis and early purification stages

    • Consider working at lower temperatures to reduce proteolytic activity

  • Storage conditions:

    • Avoid repeated freeze-thaw cycles which can lead to protein degradation

    • Store working aliquots at 4°C for no more than one week

    • For long-term storage, maintain at -20°C/-80°C with 50% glycerol

  • Activity considerations:

    • Control zinc concentration carefully when activating the enzyme

    • Be aware that the protein may cleave itself once activated with zinc

    • Consider using zinc chelators to temporarily inactivate the enzyme when needed

  • Experimental design:

    • Include appropriate controls for zinc dependency

    • Use proper buffer systems, typically Tris-based buffers at pH 8.0

    • Account for potential membrane interactions in assay design

What methods can be used to study the substrate specificity of A. vitis HtpX?

Understanding the substrate specificity of A. vitis HtpX requires systematic approaches:

  • Peptide library screening:

    • Use fluorogenic peptide libraries with different amino acid sequences

    • Monitor cleavage rates to identify preferred sequence motifs

    • Compare results with known specificities of other HtpX homologs

  • Proteomic identification of cleaved proteins:

    • Incubate membrane preparations with active HtpX

    • Use mass spectrometry to identify cleavage products

    • Analyze cleavage sites to determine consensus sequences

  • Site-directed mutagenesis of putative substrates:

    • Modify potential cleavage sites in known substrates

    • Test the effect on degradation efficiency

    • Map the critical residues for substrate recognition

Based on studies with E. coli HtpX, which cleaves SecY and degrades casein, A. vitis HtpX likely has both membrane protein-specific activity and the ability to cleave soluble proteins under certain conditions .

How does A. vitis HtpX contribute to bacterial pathogenicity and plant infections?

The role of A. vitis HtpX in pathogenicity can be investigated through several experimental approaches:

  • Knockout studies in Agrobacterium strains:

    • Generate htpX deletion mutants in A. vitis

    • Compare virulence of wild-type and mutant strains on host plants

    • Assess the ability to cause crown gall disease

  • Stress response during plant infection:

    • Monitor htpX expression levels during different stages of infection

    • Determine if plant defense responses trigger increased htpX expression

    • Investigate whether HtpX helps A. vitis survive plant antimicrobial defenses

  • Interaction with virulence factors:

    • Study potential processing of virulence proteins by HtpX

    • Investigate relationships between HtpX and the vir gene products

    • Examine coexpression patterns with other pathogenicity genes

A. vitis is a causative agent of crown gall disease in grapevines, and pathogens of this genus are detected using virulence and oncogene-specific primer combinations . The potential role of HtpX in maintaining membrane protein quality during infection stress represents an area for further research.

How do mutations in conserved domains affect A. vitis HtpX activity?

To investigate the functional importance of conserved domains in A. vitis HtpX, the following methodological approach is recommended:

  • Structural analysis and domain identification:

    • Perform multiple sequence alignment of HtpX homologs to identify conserved regions

    • Use computational tools to predict functionally important domains

    • Focus on zinc-binding motifs and catalytic sites

  • Site-directed mutagenesis strategy:

    • Create point mutations in conserved residues, particularly:

      • Predicted zinc-binding sites

      • Catalytic residues

      • Membrane-spanning domains

      • Substrate recognition regions

  • Functional characterization:

    • Express and purify mutant proteins

    • Compare proteolytic activity against standard substrates

    • Assess zinc binding capability

    • Examine membrane association properties

Computational proteomic studies indicate that HtpX homologs contain both conserved exposed residues (19 identified) and conserved buried residues (38 identified), which likely play critical roles in structural integrity and catalytic function .

What are the evolutionary relationships between HtpX proteases across different bacterial species?

Investigating the evolutionary relationships between HtpX proteases requires phylogenetic analysis approaches:

  • Comprehensive sequence gathering:

    • Collect HtpX sequences from diverse bacterial species

    • Include sequences from various Agrobacterium species and strains

    • Incorporate well-characterized homologs like E. coli HtpX

  • Multiple sequence alignment and phylogenetic analysis:

    • Perform alignments using tools like CLUSTALW

    • Construct phylogenetic trees using methods such as Maximum Likelihood in MEGA11

    • Analyze evolutionary rates of specific residues using ConSurf

  • Domain conservation analysis:

    • Identify which domains are most conserved across species

    • Determine if functional motifs show different evolutionary rates

    • Compare membrane-spanning regions versus catalytic domains

Recent computational studies suggest that proteins like HtpX are relatively well-conserved across bacterial species, with homologs showing similar physicochemical properties (slightly acidic to basic, thermally stable, and hydrophobic for membrane residence). Polynucleobacter necessarius has been identified as a potential ancestral organism for some of these proteases, suggesting common evolutionary pathways for these virulence factors .

What proteins interact with A. vitis HtpX in vivo and how can these interactions be studied?

Investigating protein-protein interactions involving A. vitis HtpX requires multiple complementary approaches:

  • Computational prediction methods:

    • Use STRING database analysis to identify potential interaction partners

    • Based on related organisms, potential partners may include:

      • FtsH (another membrane protease)

      • Chaperones like GrpE

      • Membrane protein assembly factors

  • Experimental validation techniques:

    • Bacterial two-hybrid system adapted for membrane proteins

    • Co-immunoprecipitation with tagged HtpX

    • Cross-linking followed by mass spectrometry identification

    • Pull-down assays with purified HtpX

  • Functional validation approaches:

    • Co-expression studies to identify genetic interactions

    • Phenotypic analysis of double mutants

    • Reconstitution of protein complexes in vitro

Studies on related systems suggest that HtpX likely works in conjunction with other quality control systems, particularly with FtsH, a membrane-bound ATP-dependent protease, to maintain membrane protein homeostasis under stress conditions .

How does A. vitis HtpX integrate into cellular stress response pathways?

To understand the role of A. vitis HtpX in stress response networks, researchers should consider:

  • Expression analysis under various stress conditions:

    • Heat shock (as suggested by its classification as a heat shock protein)

    • Oxidative stress

    • Membrane-damaging agents

    • Plant defense compounds

  • Transcriptional regulation studies:

    • Identify promoter elements controlling htpX expression

    • Determine transcription factors that regulate htpX

    • Map the stress response regulons that include htpX

  • Systems biology approaches:

    • Conduct proteomics studies under stress conditions with and without functional HtpX

    • Perform metabolomics analysis to identify downstream effects of HtpX activity

    • Develop network models integrating HtpX with other stress response proteins

Based on pathway analysis and protein-protein interaction studies in related systems, HtpX likely integrates with stress response pathways including heat shock response and membrane protein quality control systems. In particular, it appears to function in conjunction with proteins like FtsH, sharing overlapping roles in degrading misfolded membrane proteins .

What role does A. vitis HtpX play in fine chemical production pathways?

The potential applications of A. vitis HtpX in fine chemical production can be investigated through:

  • Methionine biosynthesis pathway interactions:

    • Study the effect of HtpX overexpression on methionine production

    • Investigate potential processing of methionine biosynthesis enzymes by HtpX

    • Examine metabolic changes in cells with altered HtpX activity

  • Experimental approaches:

    • Overexpress or delete htpX in production strains

    • Quantify methionine and other amino acid levels

    • Monitor relevant biosynthetic enzyme activities and stability

  • Protein engineering for improved production:

    • Design HtpX variants with altered substrate specificity

    • Create conditional expression systems for controlled protease activity

    • Develop fusion proteins targeting specific metabolic pathways

Patent literature indicates that increased or generated HtpX activity can enhance the production of fine chemicals, particularly methionine, in free or bound form. This suggests a potential role for HtpX in modulating metabolic pathways related to amino acid biosynthesis, possibly through selective degradation of regulatory proteins or processing of key enzymes .

How can computational approaches advance our understanding of A. vitis HtpX structure and function?

Modern computational methods offer powerful tools for investigating A. vitis HtpX:

  • Structure prediction and modeling:

    • Use AlphaFold or similar AI-based tools to predict HtpX structure

    • Perform molecular dynamics simulations to understand membrane integration

    • Model zinc binding and substrate interaction sites

  • Sequence-structure-function relationships:

    • Apply per-site evolutionary rate estimation using tools like ConSurf

    • Identify functionally critical residues that are conserved across species

    • Map disordered regions that may provide functional flexibility

  • Virtual screening for inhibitors or activators:

    • Develop computational models for the active site

    • Screen chemical libraries for potential modulators

    • Design peptide inhibitors based on substrate preferences

Recent computational proteomic studies on HtpX homologs revealed that these proteins typically contain 18-44% disordered regions, which likely provide functional flexibility for assembling macromolecular complexes and interacting with host cell receptors. Additionally, the identification of conserved exposed and buried residues provides targets for site-directed mutagenesis to better understand structure-function relationships .

What therapeutic applications might emerge from A. vitis HtpX research?

Research on A. vitis HtpX could lead to several therapeutic applications:

  • Agricultural disease management:

    • Development of specific inhibitors targeting A. vitis HtpX

    • Design of diagnostic tools for early detection of crown gall disease

    • Creation of resistant crop varieties expressing HtpX inhibitors

  • Antimicrobial strategies:

    • Structure-based design of broad-spectrum inhibitors targeting conserved features of bacterial HtpX proteases

    • Combination therapies targeting multiple proteolytic systems

    • Peptidomimetics that compete for HtpX binding sites

  • Research approach roadmap:

    • High-throughput screening for inhibitory compounds

    • Validation in plant infection models

    • Assessment of specificity against other metalloproteases

    • Evaluation of resistance development

Computational studies suggest that understanding the conserved residues and functional domains of HtpX could lead to the development of effective therapeutic strategies against infections caused by Agrobacterium species, potentially preventing crown gall disease in economically important crops like grapevines .

How might A. vitis HtpX be engineered for biotechnological applications?

Engineering A. vitis HtpX for biotechnological applications presents several opportunities:

  • Enzyme engineering approaches:

    • Modify substrate specificity through targeted mutations

    • Enhance stability for industrial applications

    • Create chimeric enzymes with novel functions

    • Develop conditional activity switches

  • Potential biotechnological applications:

    • Fine chemical production, particularly amino acids like methionine

    • Protein processing in industrial enzyme production

    • Selective degradation of target proteins in engineered biological systems

    • Biosensors for zinc or specific protein substrates

  • Experimental design considerations:

    • Directed evolution to improve desired properties

    • Rational design based on structural information

    • High-throughput screening methods for activity assessment

    • In vitro versus in vivo optimization strategies

Patent literature suggests that manipulating HtpX activity can increase the production of fine chemicals, particularly methionine. This indicates potential applications in metabolic engineering for improved amino acid production, which has significant commercial value in the food, feed, and pharmaceutical industries .

Why might recombinant A. vitis HtpX show low or no activity in my experiments?

Several factors can contribute to low or absent activity of recombinant A. vitis HtpX:

  • Zinc-related issues:

    • Insufficient zinc in reaction buffer (HtpX is a zinc-dependent metalloprotease)

    • Excess zinc causing inhibition

    • Zinc chelation by buffer components

  • Protein quality problems:

    • Improper folding during expression or refolding

    • Self-degradation during purification or storage

    • Aggregation or precipitation

    • Inactive conformation due to tag interference

  • Experimental conditions:

    • Suboptimal pH (typically requires pH around 8.0)

    • Improper temperature

    • Presence of inhibitors in the reaction mixture

    • Degradation of the substrate before analysis

  • Methodological approach to troubleshooting:

    • Verify protein integrity by SDS-PAGE

    • Include positive controls (known active proteases)

    • Test activity using multiple substrates

    • Systematically vary zinc concentration

Based on studies with E. coli HtpX, proper refolding in the presence of a zinc chelator followed by zinc addition is critical for obtaining active enzyme. Additionally, the storage conditions should avoid repeated freeze-thaw cycles which can lead to protein degradation .

What are the best methods for quantifying A. vitis HtpX catalytic activity?

For accurate quantification of A. vitis HtpX catalytic activity, the following methods are recommended:

  • Fluorogenic peptide substrates:

    • Use peptides containing fluorophore-quencher pairs

    • Measure fluorescence increase upon cleavage

    • Calculate kinetic parameters (Km, kcat, Vmax)

  • Protein substrate degradation assays:

    • Incubate with model substrates like casein

    • Quantify degradation by:

      • SDS-PAGE with densitometry

      • Release of acid-soluble peptides

      • Loss of substrate function

  • Data analysis approaches:

    • Use initial velocity measurements for enzymatic parameters

    • Apply Michaelis-Menten kinetics for quantitative analysis

    • Perform comparative analysis with E. coli HtpX as reference

  • Activity standardization:

    • Express activity in standard units (μmol substrate cleaved per minute)

    • Include internal standards for cross-experiment comparison

    • Account for self-cleavage in activity calculations

E. coli HtpX has been shown to cleave SecY and degrade casein in the presence of zinc, making these potentially useful substrates for activity assays. The ability to monitor self-cleavage of HtpX itself can also serve as an activity indicator .

Comparative Analysis Table of HtpX Homologs

OrganismProtein LengthKey FeaturesLocalizationKnown SubstratesReference
Agrobacterium vitis342 aaZinc-dependent metalloprotease, 34 aa signal peptidePrimarily periplasmicNot fully characterized
Agrobacterium tumefaciens321 aaSimilar structure to A. vitis HtpXMembrane-boundNot fully characterized
Escherichia coli~300 aaSelf-cleavage activity, works with FtsHMembrane-boundSecY, casein
Polynucleobacter necessariusNot specifiedPutative ancestral formMembrane-boundNot characterized

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.