Recombinant Agrobacterium vitis UPF0283 membrane protein Avi_2471 (Avi_2471)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Agrobacterium vitis UPF0283 Membrane Protein Avi_2471 (Avi_2471)

The protein "Recombinant Agrobacterium vitis UPF0283 membrane protein Avi_2471" (Avi_2471) is a hypothetical protein derived from the bacterium Agrobacterium vitis. A. vitis is a Gram-negative bacterium known primarily as the causal agent of grapevine crown gall disease, a significant phytopathogen affecting grape production worldwide . Avi_2471 is classified as a UPF0283 (Unknown Protein Function) membrane protein, indicating that its precise function remains to be fully elucidated through experimental studies. Membrane proteins like Avi_2471 are crucial for various cellular processes, including transport, signaling, and maintaining cell structure .

Genomic Context and Characteristics

The avi_2471 gene is part of the Agrobacterium vitis genome. Genome sequencing projects provide the basic information necessary to identify and characterize genes like avi_2471 . The virF gene, found on Ti plasmids of A. vitis, is essential for virulence . The virF gene on pTiAg57 codes for a protein of 202 amino acids with a molecular mass of 22,280 Da .

Functional Prediction and Potential Roles

  • Membrane Integrity and Structure: Contributing to the stability and structure of the bacterial cell membrane.

  • Transport Processes: Facilitating the transport of molecules across the membrane.

  • Cell Signaling: Participating in signal transduction pathways.

  • Interaction with Host Plants: Mediating interactions between the bacterium and its host plant, the grapevine.

Another Agrobacterium tumefaciens small lipoprotein, Atu8019, is involved in outer membrane vesicle docking to bacterial cells, suggesting a role in cell adhesion .

Experimental Studies and Research Findings

Existing research provides insight into the behavior of Agrobacterium under various conditions, including:

  • Root Surface Attachment: Studies on Azotobacter vinelandii have identified proteins like Avin_16040 that are involved in attachment to plant root surfaces, biofilm formation, and cell surface hydrophobicity .

  • Virulence Factors: Research on the VirF protein in Agrobacterium vitis demonstrates its role in host range determination and tumor formation .

  • Transformation Efficiency: Work on Agrobacterium-mediated plant transformation has shown that specific vir helper plasmids can enhance T-DNA delivery efficiency .

While these studies do not directly address Avi_2471, they provide a framework for investigating its potential functions.

Future Research Directions

Further research is needed to elucidate the precise function of Avi_2471. Potential research directions include:

  • Expression Analysis: Studying the expression patterns of the avi_2471 gene under different conditions, such as during infection of grapevine or in response to specific environmental stimuli.

  • Structural Studies: Determining the three-dimensional structure of the protein to gain insights into its potential function.

  • Interaction Studies: Identifying the proteins and other molecules that interact with Avi_2471.

  • Mutational Analysis: Creating mutations in the avi_2471 gene and studying the effects on bacterial phenotype, such as virulence, growth, and stress tolerance.

  • Proteomic Analysis: Analyzing the proteome of Agrobacterium vitis to identify changes in protein expression in response to different conditions.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Avi_2471; UPF0283 membrane protein Avi_2471
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Agrobacterium vitis (strain S4 / ATCC BAA-846) (Rhizobium vitis (strain S4))
Target Names
Avi_2471
Target Protein Sequence
MSKAPEDQRPMPRRPAAFSLEEPSSSPARPPFAEAQEPQRRAPKSFDANVTITPDAEDPF LAGLSEDEAILPIARPAKRRFSFGKLAGAAFGALASFAIGLWIDDLIRDLFTRADWLGYT ALTLLGIGLLALTVVVIRELAGIYRLNAVQAIKQRASALSLQGTASEARKLVKDVEDLTQ HRAETARGRSVLKAAENDIIDAPHLIALAERELLAPLDAKARSLIINASKRVSVVTAVSP RALVDLAYVLFEVVRLVRAMAELYGGRPGSIGMLRLLRDVFAHLAVTGSIAIGDGLAQQV LGHGLASRLSARLGEGVINGLMTARIGIAAMDLCRPLEFKALRRPGIGDFMPALKPAINP DSKAL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing Avi_2471?

The primary expression system used for Avi_2471 is E. coli, as documented in available recombinant protein resources . When working with membrane proteins like Avi_2471, researchers should consider several optimization approaches:

Expression SystemAdvantagesLimitationsRecommended Use
Standard E. coliCost-effective, scalableMay form inclusion bodiesInitial screening
C41/C43 E. coli strainsOptimized for membrane proteinsMay still yield low amountsImproved expression
Cell-free systemsAvoids toxicity issuesHigher cost, smaller scaleDifficult-to-express constructs
Insect cellsBetter for complex proteinsLonger process, more expensiveWhen bacterial systems fail

For Avi_2471, starting with E. coli BL21(DE3) with induction at lower temperatures (16-20°C) is recommended, with careful optimization of induction conditions to maximize properly folded protein yield .

How should researchers interpret the "UPF0283" designation?

The UPF (Uncharacterized Protein Family) designation indicates this is a protein family with conserved sequence across multiple organisms but without experimentally determined function. For Avi_2471, this presents both a challenge and an opportunity for researchers interested in:

  • Functional annotation of previously uncharacterized protein families

  • Discovery of novel bacterial membrane protein functions

  • Comparative genomics across bacterial species

When approaching UPF proteins, researchers should employ both computational predictions and experimental approaches, including sequence homology analysis, structural predictions, and phenotypic studies of gene deletion mutants in the native organism .

What strategies can optimize Avi_2471 solubilization and purification?

Membrane protein purification presents unique challenges due to their hydrophobic nature. For Avi_2471, consider the following methodological approach:

  • Membrane isolation: After cell lysis, separate membranes by ultracentrifugation

  • Detergent screening: Test multiple detergents at varying concentrations, starting with:

DetergentCMC (%)Working ConcentrationBest For
DDM0.00871-2% for extraction, 0.05% for purificationInitial extraction
LMNG0.0010.5-1% for extraction, 0.01% for purificationMaintaining stability
Triton X-1000.021% for extraction, 0.1% for purificationCost-effective option
  • IMAC purification: Utilize the His-tag with Ni-NTA resin, implementing stepwise imidazole elution (50mM, 100mM, 250mM, 500mM) to separate non-specific binders

  • Buffer optimization: Include 20% glycerol and 150-300mM NaCl to improve stability

  • Size exclusion chromatography: As a final polishing step to ensure homogeneity and remove aggregates

The choice of detergent significantly impacts both yield and functional properties, so systematic screening is essential for optimal results.

How can researchers assess the structural integrity of purified Avi_2471?

Confirming proper folding and structural integrity of membrane proteins is crucial before functional studies. For Avi_2471, implement a multi-method validation approach:

  • Size and purity assessment:

    • SDS-PAGE (expected MW ~40kDa plus tag)

    • Western blot with anti-His antibodies

    • SEC-MALS for oligomerization state determination

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy to confirm alpha-helical content expected in transmembrane domains

    • FTIR spectroscopy as an alternative approach less affected by detergents

  • Thermal stability assessment:

    • Differential scanning fluorimetry with membrane protein-compatible dyes

    • Nanoscale differential scanning calorimetry

  • Membrane insertion verification:

    • Reconstitution into liposomes followed by protease protection assays

    • Sucrose gradient flotation assays to confirm membrane association

These methods provide complementary information about different aspects of protein structure and should be used in combination.

What computational methods are appropriate for predicting Avi_2471 structure?

For membrane proteins like Avi_2471, computational structural analysis plays a vital role, especially when experimental structures are challenging to obtain:

These computational approaches provide testable hypotheses about protein structure that can guide experimental design.

How can researchers experimentally determine the membrane topology of Avi_2471?

Determining the orientation and membrane insertion pattern of Avi_2471 requires specialized experimental approaches:

  • Accessibility mapping:

    • Cysteine scanning mutagenesis followed by labeling with membrane-impermeable reagents

    • SCAM (Substituted Cysteine Accessibility Method) to identify exposed regions

  • Protease protection assays:

    • Limited proteolysis of the protein in proteoliposomes or membrane vesicles

    • Mass spectrometry identification of protected fragments

  • Reporter fusion approaches:

    • PhoA (alkaline phosphatase) fusions, which are active only when located in the periplasm

    • GFP fusions, which fluorescence when cytoplasmic but not when periplasmic

    • Dual reporter systems for comprehensive mapping

  • Direct structural methods:

    • Cryo-electron microscopy for high-resolution structure determination

    • EPR spectroscopy with site-directed spin labeling for distance measurements and accessibility

These techniques can be combined to create a comprehensive topological map of Avi_2471 in the membrane.

What approaches can identify the function of this uncharacterized membrane protein?

Given the unknown function of UPF0283 family proteins, a systematic approach to functional characterization is required:

  • Sequence-based function prediction:

    • BLAST against functionally annotated proteins

    • Analysis of conserved motifs and domains using InterPro and Pfam

    • Phylogenetic profiling to identify co-evolved genes

  • Molecular biology approaches:

    • Knockout/knockdown studies in A. vitis to determine phenotypic effects

    • Complementation assays in related bacterial species

    • Transcriptional context analysis (what genes are co-expressed?)

  • Biochemical function screening:

    • Test for enzymatic activities (hydrolase, transferase, etc.)

    • Transport assays using reconstituted proteoliposomes

    • Binding assays with potential ligands identified through computational predictions

  • Protein-protein interaction analysis:

    • Pull-down assays using the His-tagged protein

    • Bacterial two-hybrid screens

    • In situ crosslinking followed by mass spectrometry

These methodologies provide complementary information that can collectively indicate the protein's function.

How might Avi_2471 be involved in Agrobacterium vitis pathogenicity?

As a membrane protein in a plant pathogen, Avi_2471 could potentially contribute to virulence through several mechanisms:

  • Host-pathogen interface functions:

    • Adhesion to plant cells

    • Sensing plant defense compounds

    • Transport of virulence factors

  • Experimental approaches to test pathogenicity roles:

ApproachMethodologyExpected Outcome
Gene deletionCRISPR/Cas or homologous recombination in A. vitisAltered virulence phenotype if involved in pathogenicity
Expression analysisqRT-PCR or RNA-seq during infection processDifferential expression during key infection stages
Plant responseMonitor plant defense responses to wildtype vs. Avi_2471 mutantsDifferent immune responses if involved in PAMP recognition
LocalizationFluorescent protein fusion during infectionConcentration at infection sites would suggest direct role
  • Comparative genomics approach:

    • Compare presence/absence and sequence variation across pathogenic and non-pathogenic Agrobacterium species

    • Analyze co-occurrence with known virulence factors

These studies could reveal whether Avi_2471 represents a potential target for developing strategies to control A. vitis infections in plants.

How can Avi_2471 be reconstituted into artificial membrane systems?

For functional studies, reconstitution into membrane mimetics provides a controlled environment to study Avi_2471:

  • Proteoliposome preparation:

    • Select appropriate lipid composition (typically E. coli polar lipids or synthetic mixtures)

    • Mix purified protein with detergent-solubilized lipids at protein:lipid ratios of 1:100 to 1:1000

    • Remove detergent gradually using Bio-Beads, dialysis, or controlled dilution

    • Verify reconstitution by freeze-fracture electron microscopy or flotation assays

  • Nanodiscs incorporation:

    • Prepare MSP (Membrane Scaffold Protein) and lipids

    • Mix with purified Avi_2471 in specific ratios

    • Remove detergent to allow self-assembly

    • Purify resulting nanodiscs by size exclusion chromatography

  • Supported lipid bilayers:

    • Form bilayers on solid supports (mica, glass)

    • Incorporate Avi_2471 through direct addition or vesicle fusion

    • Analyze by AFM or single-molecule fluorescence techniques

These reconstitution systems enable detailed functional and structural studies in a near-native lipid environment.

What site-directed mutagenesis approaches would elucidate Avi_2471 structure-function relationships?

Systematic mutagenesis can reveal critical functional regions within Avi_2471:

  • Residue selection strategy:

    • Target highly conserved amino acids identified through multiple sequence alignment

    • Focus on charged residues within predicted transmembrane regions

    • Examine residues at predicted interfaces or potential binding sites

  • Mutation design principles:

Mutation TypeExamplePurpose
Alanine scanningR→A, D→A, K→AIdentify essential charged residues
Conservative substitutionsK→R, D→ETest specific chemical properties
Radical substitutionsK→L, D→NProbe tolerance to major changes
Cysteine introductionX→CEnable site-specific labeling
  • Functional consequences assessment:

    • Express and purify each mutant

    • Compare structural integrity using CD spectroscopy

    • Measure functional parameters and compare to wild-type

    • Map results onto structural models to identify functional domains

This systematic approach can reveal critical residues involved in protein folding, stability, and function.

How can researchers overcome low expression or poor solubility of Avi_2471?

Membrane proteins like Avi_2471 often present expression challenges that require systematic optimization:

  • Expression vector modifications:

    • Test multiple fusion partners (MBP, SUMO, Mistic) that enhance membrane protein solubility

    • Optimize codon usage for expression host

    • Try different promoters (T7, tac, arabinose-inducible) for varied expression levels

  • Expression condition optimization:

ParameterRange to TestRationale
Temperature16-30°CLower temperatures reduce aggregation
Inducer concentration0.1-1.0 mM IPTGLower concentrations can improve folding
Media compositionLB, TB, M9, auto-inductionDifferent media affect expression levels
Addition of additivesGlycerol, sorbitol, benzyl alcoholCan stabilize membrane proteins
  • Host strain selection:

    • C41/C43 (specifically evolved for membrane protein expression)

    • Rosetta (supplies rare tRNAs)

    • SHuffle (enhanced disulfide bond formation if needed)

Systematic testing of these parameters, ideally using a factorial experimental design, can identify optimal expression conditions.

What quality control methods ensure experiment-ready Avi_2471 preparations?

Ensuring consistent quality of purified Avi_2471 is critical for reliable experimental results:

  • Purity assessment:

    • SDS-PAGE with densitometry (aim for >90% purity)

    • Mass spectrometry to confirm identity and detect modifications

    • Dynamic light scattering to assess homogeneity

  • Functional validation:

    • Establish a simple activity or binding assay as a functional QC step

    • Monitor thermal stability using differential scanning fluorimetry

    • Track batch-to-batch variation using standardized assays

  • Storage optimization:

    • Test stability at different temperatures (-80°C, -20°C, 4°C)

    • Evaluate freeze-thaw cycles impact on activity

    • Assess different buffer components (glycerol content, salt concentration)

    • Consider flash-freezing in liquid nitrogen versus slow freezing

Implementing a standardized quality control workflow ensures reproducible results across experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.