Recombinant Agrostis stolonifera Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPDKKNILVIGPVPG KKYSEIVFPILSPDPATKKDAYFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVR KILRKEKGGYEISIVDASDGRQVIDTIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function

Recombinant Agrostis stolonifera Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for Recombinant Agrostis stolonifera Apocytochrome f?

For optimal preservation of protein integrity and activity, Recombinant Agrostis stolonifera Apocytochrome f should be stored at -20°C in a Tris-based buffer containing 50% glycerol . For extended storage periods, -80°C is recommended to minimize degradation. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of functional properties . When handling the protein for experimental purposes, maintaining cold chain conditions and using appropriate protease inhibitors is advised to preserve structural integrity and biological activity.

How does heat stress affect the interaction between Apocytochrome f and small heat-shock proteins in Agrostis stolonifera?

Research on Agrostis stolonifera has revealed significant insights into the protective mechanisms of small heat-shock proteins (sHsps) on photosynthetic apparatus during heat stress. In vivo experiments with A. stolonifera genotypes that differ in thermotolerance demonstrated that chloroplast sHsps can associate with thylakoid membranes and specifically protect Photosystem II during heat stress . The heat-tolerant genotype produces a greater quantity of chloroplast and thylakoid-associated sHsps, including an additional isoform not present in heat-sensitive genotypes. Cross-linking experiments showed increased association of sHsps with PSII proteins during heat stress in tolerant genotypes . While direct interaction with Apocytochrome f has not been specifically documented, the protective effect extends to the oxygen-evolving complex (OEC) proteins and O2-evolving function of PSII, suggesting a comprehensive protection mechanism for the electron transport chain components.

What methodological approaches are most effective for studying post-translational modifications of Apocytochrome f?

Study of post-translational modifications of Apocytochrome f requires a multi-faceted approach combining molecular biology, biochemistry, and advanced analytical techniques. Site-directed mutagenesis has proven particularly valuable, as demonstrated in studies with Chlamydomonas reinhardtii where researchers investigated the interplay between protein processing and heme attachment . This approach allows for systematic modification of key residues involved in processing and heme ligation.

For comprehensive analysis, the following methodological pipeline is recommended:

  • Gene cloning and expression: Isolate the petA gene from A. stolonifera and express it in suitable expression systems.

  • Site-directed mutagenesis: Modify specific residues involved in processing or heme binding.

  • Protein purification: Isolate the recombinant protein using affinity chromatography.

  • Mass spectrometry: Identify specific post-translational modifications and their locations.

  • In vitro processing assays: Assess the efficiency of processing enzymes on wild-type and mutant proteins.

  • Spectroscopic analysis: Monitor heme incorporation using absorption spectroscopy.

  • Functional reconstitution: Assess the activity of processed proteins in artificial membrane systems.

This integrated approach provides detailed insights into the processing pathway, from the precursor to the mature, functional protein.

What are the challenges and solutions in achieving stable expression of recombinant Apocytochrome f in heterologous systems?

Expression of functional Apocytochrome f in heterologous systems presents several challenges due to its complex maturation pathway involving membrane insertion, signal peptide cleavage, and covalent heme attachment. Research has shown that proper folding and heme attachment are interdependent processes that require specific cellular machinery .

ChallengeManifestationSolution Strategy
Inefficient processingAccumulation of precursor formsCo-expression of thylakoid processing peptidase
Poor heme attachmentProduction of apo-proteinCo-expression of c-type cytochrome biogenesis factors
Protein instabilityRapid degradationOptimization of growth conditions (temperature, induction)
Toxicity to hostGrowth inhibitionUse of tightly regulated expression systems
Membrane insertionFormation of inclusion bodiesFusion with solubility-enhancing tags or expression as soluble domain
Improper foldingNon-functional proteinCo-expression of chloroplast chaperones

Successful expression strategies often involve using specialized strains that provide the necessary post-translational modification machinery. For example, bacterial expression systems supplemented with cytochrome c maturation (Ccm) proteins have shown promising results for heterologous production of c-type cytochromes . Additionally, optimization of codon usage for the expression host and careful control of expression conditions can significantly improve yields of functional protein.

How can Recombinant Agrostis stolonifera Apocytochrome f be used in photosystem reconstitution experiments?

Recombinant Apocytochrome f can serve as a valuable tool for in vitro reconstitution of photosynthetic electron transport chains. For successful reconstitution experiments, researchers should:

  • Ensure proper maturation of the recombinant protein, including correct folding and heme attachment.

  • Incorporate the protein into artificial membrane systems (liposomes or nanodiscs) that mimic the thylakoid environment.

  • Co-reconstitute with other components of the cytochrome b6f complex and adjacent photosynthetic complexes.

  • Monitor electron transfer efficiency using spectroscopic techniques and artificial electron donors/acceptors.

The reconstituted systems allow for detailed investigation of electron transfer kinetics, protein-protein interactions, and the effects of environmental conditions on photosynthetic efficiency . Importantly, comparing wild-type and mutant forms of Apocytochrome f in these systems can provide insights into structure-function relationships and the molecular basis of environmental stress responses.

What genetic transformation approaches are most effective for studying Apocytochrome f function in Agrostis stolonifera?

Genetic transformation of A. stolonifera provides powerful tools for investigating Apocytochrome f function in vivo. Based on research with transgenic A. stolonifera, the following approaches have proven effective:

  • Agrobacterium-mediated transformation: Allows for stable integration of transgenes, as demonstrated in the development of glyphosate-resistant A. stolonifera expressing CP4 EPSPS .

  • Chloroplast transformation: Particularly relevant for petA gene studies since Apocytochrome f is encoded by the chloroplast genome. This approach enables site-specific integration and high expression levels .

  • CRISPR/Cas9 genome editing: Enables precise modification of the petA gene to investigate specific domains and residues.

For experimental design, researchers should consider:

  • Selection markers appropriate for A. stolonifera

  • Tissue-specific or inducible promoters to control transgene expression

  • Molecular markers for tracking transgene flow and integration

  • Appropriate controls to distinguish phenotypic effects from transformation-induced variations

The choice of transformation method should be guided by the specific research question, with consideration of factors such as required expression level, need for tissue specificity, and potential ecological considerations .

How can molecular markers be used to track Apocytochrome f variants in Agrostis stolonifera populations?

Molecular markers provide powerful tools for tracking naturally occurring or experimentally introduced Apocytochrome f variants in A. stolonifera populations. Simple sequence repeat (SSR) markers have been developed specifically for A. stolonifera genetic research and can be used for linkage mapping and population genetic studies . For Apocytochrome f specifically, the following approaches are recommended:

  • Development of petA-specific SSR markers: Utilizing the 215 genomic SSR markers characterized for A. stolonifera to identify those linked to the petA gene .

  • Single nucleotide polymorphism (SNP) detection: For identifying specific variants in the petA gene sequence.

  • Chloroplast DNA markers: Since petA is chloroplast-encoded, chloroplast-specific markers like matK can be used to track maternal inheritance patterns .

These molecular tools enable:

  • Population-level screening for natural variants

  • Monitoring transgene flow in field trials

  • Association studies linking genetic variants to phenotypic traits

  • Phylogeographic analysis of variant distribution

In field research settings, these molecular approaches have been successfully employed to detect transgene escape, as demonstrated in studies tracking CP4 EPSPS transgenes in wild A. stolonifera populations .

How does Apocytochrome f expression and function change under different environmental stressors in Agrostis stolonifera?

Agrostis stolonifera, as a perennial turfgrass adapted to diverse habitats, exhibits complex responses to environmental stressors at the molecular level. Research on heat stress responses has provided particularly valuable insights into how photosynthetic components, including electron transport chain proteins, respond to environmental challenges.

Environmental StressorEffect on Apocytochrome fAssociated Protective Mechanisms
Heat stressPotential degradation, reduced activityInduction of chloroplast sHsps that protect PSII and electron transport components
DroughtAltered expression patternsAdjustments in photosynthetic capacity and photoprotection mechanisms
High lightIncreased photodamage riskUpregulation of repair mechanisms and protective proteins
Cold stressReduced processing efficiencyExpression of cold-specific protective proteins

What role does Apocytochrome f play in the heat tolerance mechanisms of different Agrostis stolonifera genotypes?

Research on A. stolonifera genotypes with differential heat tolerance has revealed important insights into protection mechanisms of photosynthetic apparatus under heat stress. While Apocytochrome f itself has not been directly implicated as a primary determinant of heat tolerance, the integrity of the electron transport chain it participates in is critical for maintaining photosynthetic function under stress conditions.

Heat-tolerant A. stolonifera genotypes demonstrate:

  • Higher production of chloroplast small heat-shock proteins (sHsps) that associate with thylakoid membranes

  • Enhanced protection of Photosystem II (PSII) function during heat stress

  • Specific protection of the oxygen-evolving complex (OEC) proteins and O2-evolving function

  • Maintenance of photosynthetic electron transport under elevated temperatures

How can genetic markers be used to monitor the spread of engineered Apocytochrome f genes in field trials?

Monitoring the spread of engineered genes in Agrostis stolonifera field trials requires robust genetic tracking systems. Based on research experience with transgenic A. stolonifera, the following methodological approach is recommended:

  • Development of specific molecular markers for the engineered petA gene variants

  • Establishment of a systematic sampling protocol covering:

    • The field trial site itself

    • Buffer zones surrounding the trial

    • Natural habitats at increasing distances from the trial

    • Particular focus on downwind locations and mesic habitats

  • Multilevel screening approach:

    • Initial protein-based screening using immunological methods

    • PCR-based detection of the engineered gene sequences

    • Confirmation using nuclear ITS and chloroplast matK sequence analysis

This approach proved effective in identifying transgenic A. stolonifera plants expressing CP4 EPSPS transgenes in wild populations, with positive plants found at distances up to 3.8 km from the control area . For monitoring spread of engineered Apocytochrome f, additional consideration should be given to the fact that petA is chloroplast-encoded and therefore maternally inherited, which affects the pattern of potential spread.

The development and application of the 215 unique genomic SSR markers characterized for A. stolonifera provides additional tools for tracking genetic spread and introgression .

What are the promising avenues for using Apocytochrome f research to improve stress tolerance in commercially important grass species?

Research on Apocytochrome f and associated photosynthetic components in A. stolonifera provides several promising directions for improving stress tolerance in turfgrasses and other economically important grass species:

  • Targeted enhancement of protective mechanisms: Studies linking small heat-shock proteins to protection of photosynthetic apparatus suggest potential for engineering enhanced expression of these protective proteins in commercial varieties .

  • Identification of naturally stress-tolerant variants: The genetic diversity in A. stolonifera populations can be explored to identify naturally occurring variants with enhanced stress tolerance traits associated with photosynthetic efficiency .

  • Precision breeding guided by molecular markers: The 215 SSR markers developed for A. stolonifera enable marker-assisted selection for traits associated with photosynthetic efficiency and stress tolerance .

  • Targeted modification of electron transport components: Engineering specific modifications to Apocytochrome f or other components of the electron transport chain to enhance efficiency under stress conditions.

  • Cross-species application: Insights from A. stolonifera can be applied to other economically important grasses facing similar environmental challenges.

These approaches have significant potential for developing grass varieties with enhanced tolerance to heat, drought, and other stressors intensified by climate change, with applications ranging from turfgrass management on golf courses to forage production systems.

How might advances in structural biology techniques enhance our understanding of Apocytochrome f function in Agrostis stolonifera?

Emerging structural biology techniques offer unprecedented opportunities to deepen our understanding of Apocytochrome f function in A. stolonifera:

  • Cryo-electron microscopy (Cryo-EM): Enables visualization of the entire cytochrome b6f complex at near-atomic resolution, revealing interaction interfaces and conformational changes during electron transport.

  • X-ray crystallography of plant-specific variants: While crystal structures exist for cytochrome f from other organisms, A. stolonifera-specific structures could reveal adaptations relevant to its ecological niche.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides insights into protein dynamics and conformational changes under different environmental conditions.

  • Integrative structural biology approaches: Combining multiple techniques (X-ray, NMR, Cryo-EM, computational modeling) to build comprehensive structural models.

  • In situ structural studies: Emerging techniques for studying protein structures within their native cellular environment.

These advanced structural approaches, combined with functional studies, could reveal:

  • Specific adaptations in A. stolonifera Apocytochrome f related to environmental stress tolerance

  • Structural basis for interactions with small heat-shock proteins during stress responses

  • Conformational dynamics associated with electron transfer under varying environmental conditions

  • Structure-guided approaches to engineering enhanced function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.