Recombinant Agrostis stolonifera ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Agrostis stolonifera ATP Synthase Subunit b, Chloroplastic (atpF)

Recombinant Agrostis stolonifera ATP synthase subunit b, chloroplastic (atpF) refers to a synthesized form of the ATP synthase subunit b protein, derived from Agrostis stolonifera (creeping bentgrass), and targeted for the chloroplasts within the plant cells . ATP synthase is a crucial enzyme complex responsible for producing adenosine triphosphate (ATP), the primary energy currency of cells, through chemiosmosis . In plants, this process occurs in the chloroplasts during photosynthesis. The subunit b (atpF) is a component of the F0 sector of the ATP synthase complex, which is embedded in the chloroplast membrane and facilitates proton transport .

Function and Role of ATP Synthase Subunit b (atpF)

The ATP synthase enzyme comprises two main parts: F0 and F1. The F0 sector is a proton channel, allowing protons to flow across the membrane, while the F1 sector uses the energy from this flow to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate . Subunit b (atpF) is a vital component of the F0 sector, essential for the structural integrity and function of the entire ATP synthase complex. It helps in connecting the F0 and F1 sectors, ensuring efficient energy transfer during ATP synthesis.

Production and Characteristics of Recombinant atpF

Recombinant atpF is produced using genetic engineering techniques, where the gene encoding atpF from Agrostis stolonifera is inserted into a host organism such as Escherichia coli or yeast for expression . The resulting protein is then isolated and purified for various research and industrial applications.

Key characteristics of recombinant atpF include:

  • Source: Derived from Agrostis stolonifera (creeping bentgrass) .

  • Expression Host: Commonly expressed in E. coli, yeast, or mammalian cells .

  • Purity: Typically >90% after purification .

  • Form: Available in liquid form, often in a glycerol-containing buffer for stability .

  • Storage: Recommended storage at -20°C or -80°C to maintain stability .

Applications of Recombinant atpF

Recombinant atpF has several applications in biological research:

  • Structural Studies: Useful for determining the three-dimensional structure of the ATP synthase complex and understanding its mechanism .

  • Functional Assays: Employed in in vitro assays to study the activity and regulation of ATP synthase .

  • Antibody Production: Can be used as an antigen to generate specific antibodies for detecting and studying ATP synthase in plants .

  • Drug Discovery: Potential target for developing inhibitors that can disrupt ATP synthesis in specific organisms .

Available Recombinant atpF Products

SupplierProduct NameHost OrganismTagPrice
CUSABIO TECHNOLOGY LLCRecombinant Agrostis stolonifera ATP synthase subunit b, chloroplastic (atpF)YeastUnspecifiedContact for pricing
MyBioSourceRecombinant Agrostis stolonifera ATP synthase subunit a, chloroplastic (atpI)E. coliN/A$920.00
Creative BioMartRecombinant Full Length Roseiflexus sp. ATP synthase subunit b(atpF) ProteinE. coliHis-TaggedUnspecified
Creative BioMartRecombinant Full Length Lolium Perenne ATP synthase Subunit B, Chloroplastic(Atpf)E. coliHis-TaggedUnspecified
AnagnoticsELISA Recombinant Agrostis stolonifera ATP synthase subunit b, chloroplastic(atpF)UnspecifiedUnspecified$1,531.00

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.

Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
atpF
Target Protein Sequence
MENVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIFFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGYSEIEREKANLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANIGILGSME WKRKLN
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembrane catalytic core, and the F(0) domain, housing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) and what role does it play in chloroplasts?

ATP synthase subunit b (atpF) is a critical component of the F₀ portion of the chloroplastic F₀F₁ ATP synthase complex. This membrane-spanning protein helps anchor the F₁ catalytic domain to the thylakoid membrane while contributing to the formation of the proton channel. The atpF subunit is essential for maintaining structural integrity of the ATP synthase complex and facilitating efficient proton translocation across the thylakoid membrane, which drives ATP synthesis during photosynthesis.

Unlike its mitochondrial counterpart, chloroplastic ATP synthase operates primarily during light reactions of photosynthesis, utilizing the proton gradient established across the thylakoid membrane to synthesize ATP. The protein's structure is highly conserved across plant species, though specific adaptations may exist in creeping bentgrass that contribute to its particular environmental tolerance .

How does atpF expression relate to other ATP synthase subunits in plants?

In plants, atpF expression is coordinated with other ATP synthase subunits to ensure proper assembly and function of the complex. The expression patterns are typically regulated in response to developmental stages and environmental conditions. When investigating atpF, it's important to consider its relationship with other subunits, particularly the catalytic beta subunit (AtpB).

Research on ATP synthase in Arabidopsis thaliana has shown that beta subunits (analogous to AtpB) are encoded by multiple genes (ATP synthase subunit beta-1, beta-2, and beta-3) , suggesting complex regulation of ATP synthase expression. Similar multiplicity might exist for atpF in Agrostis stolonifera, potentially explaining differential responses to environmental stresses.

Current transcriptomic analyses indicate that genes related to ATP synthesis, including those encoding ATP synthase components, show altered expression patterns under stress conditions in creeping bentgrass. For instance, ATPF1A (ATP synthase subunit alpha) has been identified among differentially expressed genes in transgenic creeping bentgrass with enhanced drought tolerance .

Why is Agrostis stolonifera atpF of particular interest for research?

Agrostis stolonifera (creeping bentgrass) is a perennial cool-season turfgrass with exceptional tolerance to various environmental stresses, including drought, shade, and trampling. This makes its energy metabolism machinery, particularly the ATP synthase complex, an interesting subject for investigating stress adaptation mechanisms.

Recent research has demonstrated that overexpression of certain genes in creeping bentgrass leads to enhanced drought tolerance and improved shade adaptation through delayed leaf senescence. This stress tolerance is linked to alterations in energy metabolism pathways, including photosynthesis and ATP synthesis .

Studying the chloroplastic atpF from this species provides insights into how energy production systems adapt to environmental challenges, potentially revealing novel mechanisms that could be applied to improve stress tolerance in other crop species through genetic engineering approaches.

What are the most effective expression systems for producing recombinant Agrostis stolonifera atpF?

For successful expression of recombinant Agrostis stolonifera atpF, researchers should consider both prokaryotic and eukaryotic expression systems based on experimental goals:

Prokaryotic Systems:

Eukaryotic Systems:

  • Plant-based expression: Provides appropriate post-translational modifications. Transient expression in Nicotiana benthamiana or stable transformation in Arabidopsis can yield functional protein.

  • Cell-free systems: Useful for difficult-to-express membrane proteins like atpF, allowing controlled environments and avoiding toxicity issues.

Expression SystemAdvantagesLimitationsYield (approximate)
E. coli BL21(DE3)High yield, simple cultivationPossible inclusion bodies, lacks PTMs5-10 mg/L
CyanobacteriaNative-like environment, appropriate PTMsSlower growth, lower yields1-3 mg/L
N. benthamianaPlant-specific PTMs, membrane integrationLabor intensive, variable yields0.5-2 mg/g leaf
Cell-free systemControllable conditions, rapidExpensive, limited scalability0.1-1 mg/mL reaction

The FLAG-tag strategy demonstrated for cyanobacterial ATP synthase provides a promising approach for atpF purification, allowing isolation of intact and active protein complexes .

How do mutations in atpF affect ATP synthase assembly and function in photosynthetic tissues?

Mutations in atpF can significantly impact ATP synthase assembly and function through several mechanisms:

Structural Integrity: Key residues in atpF contribute to the assembly and stability of the F₀F₁ complex. Mutations in these regions can prevent proper complex formation, leading to reduced ATP synthesis capacity. Studies on bacterial ATP synthase have shown that mutations in homologous subunits can completely abolish function, as observed with the atpE mutations causing resistance to tomatidine .

Proton Channel Formation: The b subunit participates in proton translocation across the membrane. Mutations affecting conserved residues in the transmembrane domain can alter proton conductance, reducing the coupling efficiency between proton flow and ATP synthesis.

Regulatory Interactions: atpF interacts with both F₀ and F₁ components, facilitating communication between these domains. Mutations in interaction surfaces can disrupt regulatory mechanisms controlling ATP synthase activity in response to changing metabolic demands.

What are the relationships between atpF expression, ATP synthase activity, and drought tolerance in turfgrass species?

Recent research reveals complex relationships between ATP synthase function and drought tolerance in turfgrass species like Agrostis stolonifera:

Gene Expression Patterns: During drought stress, differential expression of ATP synthase components, including atpF, has been observed. Typically, moderate drought initially upregulates expression of ATP synthase genes as part of an energy mobilization response, while severe or prolonged drought leads to downregulation as photosynthesis becomes severely limited.

Energy Homeostasis: Plants with altered ATP synthase activity show modified energy utilization patterns during drought. Transgenic creeping bentgrass lines with enhanced drought tolerance demonstrate significant increases in antioxidant enzyme levels, chlorophyll content, and soluble sugars , suggesting altered ATP utilization and production under stress.

Photosynthetic Efficiency: ATP synthase function directly impacts photosynthetic efficiency under drought conditions. Plants with optimized ATP synthase activity maintain better photosynthetic performance during water limitation, preserving carbon fixation and reducing photooxidative damage.

Hormonal Regulation: Drought tolerance in creeping bentgrass is linked to hormonal regulation, particularly cytokinin signaling. Overexpression of the MtIPT gene enhances both drought tolerance and shade adaptation while affecting ATP-related genes (ATPF1A) . This suggests a regulatory network connecting hormone signaling, ATP synthesis, and stress responses.

Mutational Evidence: Research on bacterial ATP synthase provides insight into how mutations affecting ATP synthase function can alter stress responses. In Staphylococcus aureus, mutations in ATP synthase components (atpE) and electron transport chain components (ndh2, qoxC) that confer resistance to ATP synthase inhibitors significantly compromise bacterial fitness and virulence , suggesting evolutionary trade-offs between ATP synthase function and stress adaptation.

What are the optimal conditions for isolating intact and functional ATP synthase containing atpF from Agrostis stolonifera?

Isolating intact and functional ATP synthase from Agrostis stolonifera requires careful attention to preserve the native structure of this membrane-bound complex:

Sample Preparation:

  • Harvest young, actively growing leaf tissue (preferably pre-flowering stage)

  • Flash-freeze in liquid nitrogen and store at -80°C until processing

  • Perform all subsequent steps at 4°C to preserve enzymatic activity

Isolation Protocol:

  • Homogenize tissue in isolation buffer (330 mM sucrose, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA, 1 mM MgCl₂, 10 mM KCl, 5 mM DTT, 1% PVPP, protease inhibitor cocktail)

  • Filter through Miracloth and centrifuge at 3,000 g for 5 minutes to remove debris

  • Centrifuge filtrate at 10,000 g for 10 minutes to pellet chloroplasts

  • Resuspend chloroplast pellet and lyse in hypotonic buffer (10 mM HEPES-KOH pH 7.5, 4 mM MgCl₂)

  • Centrifuge at 40,000 g for 30 minutes to collect thylakoid membranes

  • Solubilize membranes with gentle detergents (0.5-1.0% n-dodecyl-β-D-maltoside or digitonin)

Purification Strategy:
Based on the cyanobacterial ATP synthase isolation protocol, a FLAG-tag approach offers excellent results for obtaining pure, active complexes . This requires:

  • Generation of transgenic plants expressing FLAG-tagged atpF or another ATP synthase subunit

  • Affinity purification using anti-FLAG resin

  • Gentle elution with FLAG peptide to preserve complex integrity

Activity Verification:

  • ATP hydrolysis assay measuring phosphate release

  • Proton pumping assay using pH-sensitive fluorescent dyes

  • Blue-native PAGE to confirm complex integrity

  • Mass spectrometry to verify subunit composition, including atpF

How can researchers effectively detect and quantify atpF protein in plant samples?

Antibody-Based Detection Methods:

  • Western Blotting: Using atpF-specific antibodies allows detection of the protein in complex samples. If commercial antibodies against Agrostis stolonifera atpF are unavailable, researchers can use antibodies against conserved regions from related species. Expected molecular weight for atpF is approximately 17-21 kDa, with recommended antibody dilutions of 1:1000-1:5000 .

  • Immunoprecipitation: For protein-protein interaction studies, use atpF antibodies conjugated to solid support for pulling down the entire ATP synthase complex.

  • Immunohistochemistry: Localize atpF within plant tissues using fluorescently labeled antibodies to study distribution patterns across different cell types.

Mass Spectrometry-Based Approaches:

  • Targeted Proteomics: Multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) provide sensitive and specific quantification of atpF peptides.

  • Label-Free Quantification: Compare atpF abundance across different samples based on spectral counting or peptide intensity measurements.

  • Isotope Labeling: SILAC or TMT labeling enables precise relative quantification across multiple experimental conditions.

Recombinant Protein Standards:
Generate purified recombinant atpF with concentration tags (e.g., His-tag) for use as quantification standards. This approach facilitates absolute quantification in biological samples through standard curve generation.

RNA-Based Quantification as Proxy:
While not directly measuring protein levels, RT-qPCR of atpF mRNA can serve as a useful proxy when protein detection is challenging, though post-transcriptional regulation should be considered when interpreting results .

What experimental designs are most effective for studying atpF function in vivo?

Genetic Modification Approaches:

  • CRISPR/Cas9 Genome Editing: Create precise mutations in atpF to study structure-function relationships. For chloroplastic genes, plastid transformation methods may be required.

  • RNAi or Antisense Strategies: Down-regulate atpF expression to assess loss-of-function phenotypes without complete gene knockout, which might be lethal.

  • Overexpression Studies: Express wild-type or modified atpF variants to investigate gain-of-function phenotypes and potential stress tolerance effects.

Functional Complementation:

  • Test whether Agrostis stolonifera atpF can functionally complement mutants of model organisms with defective ATP synthase, such as Arabidopsis or cyanobacteria.

  • Express atpF variants in heterologous systems to assess specific functional attributes without the complexity of the native genetic background.

Environmental Response Experiments:

  • Subject wild-type and atpF-modified plants to controlled stress conditions (drought, high light, temperature extremes) while monitoring photosynthetic performance, ATP/ADP ratios, and growth parameters.

  • Design factorial experiments crossing genetic modifications with environmental treatments to identify potential interaction effects.

Measurement of Physiological Parameters:

  • Chlorophyll fluorescence to assess photosynthetic efficiency

  • Oxygen evolution measurements to quantify photosynthetic capacity

  • ATP synthase activity assays using isolated thylakoids

  • ROS production monitoring under stress conditions, as ROS generation is linked to ATP synthase function under stress

How should researchers interpret contradictory results in ATP synthase functional studies?

When encountering contradictory results in ATP synthase studies, researchers should systematically evaluate several factors:

Methodological Differences:

  • Isolation Procedures: Different detergents and buffer compositions can significantly affect ATP synthase integrity and activity. Comparison of n-dodecyl-β-D-maltoside versus digitonin solubilization may reveal detergent-dependent effects on activity measurements.

  • Assay Conditions: Temperature, pH, ion concentrations, and substrate concentrations profoundly influence enzyme kinetics. Standardize these parameters when comparing across studies.

Biological Variables:

  • Developmental Stage: ATP synthase composition and activity vary with plant development. Young, actively growing tissues typically show higher ATP synthase activity than mature or senescing tissues.

  • Environmental History: Plants grown under different light regimes, temperature conditions, or watering schedules will show altered ATP synthase expression and activity .

Statistical Approaches:

  • Implement meta-analysis techniques to systematically compare results across multiple studies.

  • Use principal component analysis to identify key variables causing result divergence.

  • Apply Bayesian modeling to incorporate prior knowledge when interpreting new experimental data.

Case Example - Drought Response Studies:
When studying ATP synthase function during drought, apparently contradictory results may emerge depending on drought severity and duration. Short-term moderate drought might initially increase ATP synthase activity as part of stress response, while prolonged severe drought typically reduces activity as photosynthesis becomes impaired .

Experimental ConditionExpected ATP Synthase ResponsePotential Confounding Factors
Mild drought (early)Increased expression/activityStomatal regulation, light intensity
Severe drought (late)Decreased expression/activityLeaf senescence, photoinhibition
Recovery phaseRestoration of normal patternsPrior stress history, tissue damage

What bioinformatic approaches are most useful for analyzing atpF sequence and structural features?

Sequence Analysis Tools:

  • Multiple Sequence Alignment (MSA): Tools like MUSCLE, CLUSTAL Omega, or MAFFT for comparing atpF sequences across species to identify conserved domains and species-specific variations.

  • Phylogenetic Analysis: Methods such as Maximum Likelihood or Bayesian approaches to reconstruct evolutionary relationships of atpF across plant species, revealing potential adaptive signatures.

  • Motif Identification: MEME Suite or similar tools to identify functional motifs in the protein sequence that may be involved in specific interactions or regulatory mechanisms.

Structural Prediction:

  • 3D Structure Prediction: AlphaFold2 or RoseTTAFold can generate highly accurate structural models of atpF, particularly useful when crystal structures are unavailable.

  • Molecular Dynamics Simulations: Predict how mutations might affect protein stability and function by simulating atomic movements under different conditions.

  • Protein-Protein Interaction Modeling: Dock predicted atpF structures with other ATP synthase components to understand complex assembly and functional interactions.

Functional Annotation:

  • Gene Ontology (GO) Enrichment: Analyze functional categories associated with atpF and co-expressed genes to understand broader biological contexts.

  • Protein Domain Analysis: Tools like PFAM, SMART, or InterProScan to annotate functional domains within atpF and predict their roles.

  • Post-Translational Modification Prediction: NetPhos, UbPred, and similar tools to identify potential phosphorylation, ubiquitination, or other modification sites that might regulate atpF function.

Integration with Experimental Data:
Combine sequence/structural predictions with experimental data such as mass spectrometry-based identification of post-translational modifications or cross-linking studies revealing interaction interfaces with other subunits .

How do transcriptomic changes in atpF correlate with physiological responses to environmental stress?

Transcriptomic changes in atpF under environmental stress reveal important insights into ATP synthase regulation during adaptation processes:

Drought Stress Responses:

  • Initial moderate drought typically induces upregulation of ATP synthase genes, including atpF, as part of energy mobilization response.

  • Prolonged or severe drought generally leads to downregulation of ATP synthase components as the photosynthetic machinery becomes impaired.

  • In transgenic creeping bentgrass with enhanced drought tolerance, genes related to ATP synthesis (including ATPF1A) show differential expression patterns compared to wild-type plants .

Light Stress Integration:

  • High light conditions initially upregulate ATP synthase genes to maximize photosynthetic efficiency.

  • Under prolonged high light stress, photoprotective mechanisms may involve regulated adjustments in ATP synthase expression to prevent excess energy capture.

Temperature Effects:

  • Cold stress typically reduces ATP synthase gene expression initially, followed by recovery and potential upregulation during acclimation.

  • Heat stress responses vary depending on intensity, but often involve differential regulation of ATP synthase components to maintain energy balance.

Correlation with Physiological Parameters:
Strong correlations have been observed between ATP synthase gene expression and several physiological parameters:

Physiological ParameterCorrelation with atpF ExpressionSupporting Evidence
Photosynthetic efficiencyPositive correlation during moderate stressEnhanced chlorophyll retention in stress-tolerant plants
ROS accumulationNegative correlation (proper ATP synthase function minimizes ROS)Increased antioxidant enzyme activity in plants with optimized energy metabolism
Membrane integrityPositive correlationMaintaining proper membrane potential protects cellular structures
Hormone signalingComplex regulatory relationshipsCytokinin signaling pathways interact with energy metabolism genes

Research on transgenic creeping bentgrass has demonstrated that alterations in genes affecting cytokinin levels subsequently influence the expression of various stress response genes, including those involved in photosynthesis and ATP synthesis. These changes correlate with improved drought tolerance and delayed leaf senescence .

What are promising approaches for enhancing ATP synthase efficiency through atpF engineering?

Several innovative approaches show promise for engineering atpF to enhance ATP synthase efficiency:

Structure-Guided Mutagenesis:
Targeted modifications of atpF based on structural insights could improve proton conductance or stabilize interactions with other subunits. Mutations that strengthen the stator function without compromising flexibility might enhance coupling efficiency between proton translocation and ATP synthesis.

Chimeric Protein Design:
Creating chimeric proteins that combine the most efficient features of atpF from different species (e.g., combining domains from extremophile plants with those from Agrostis stolonifera) could produce variants with enhanced performance under specific environmental conditions.

Regulatory Element Optimization:
Engineering the regulatory regions controlling atpF expression could enable context-specific activation patterns, such as stress-induced upregulation that anticipates energy demands during environmental challenges.

Post-Translational Modification Site Engineering:
Introducing or removing specific post-translational modification sites could alter regulatory control over ATP synthase assembly or activity, potentially improving response dynamics to changing conditions.

Integration with Stress Response Networks:
Co-engineering atpF with components of stress signaling pathways could create synergistic improvements in stress tolerance. The observed relationship between cytokinin signaling and ATP synthesis suggests potential for coordinated engineering approaches .

How might functional studies of atpF contribute to broader plant biotechnology applications?

Research on atpF has significant implications for various biotechnology applications:

Crop Improvement:
Understanding how ATP synthase function relates to stress tolerance could inform strategies for developing climate-resilient crops. The connection between ATP synthase function and drought tolerance in creeping bentgrass demonstrates potential for improving water-use efficiency in agriculturally important species .

Bioenergy Applications:
Optimizing ATP synthase efficiency could enhance biomass production in bioenergy crops. Engineering more efficient energy conversion systems could improve carbon fixation rates and biomass accumulation under various environmental conditions.

Synthetic Biology Platforms:
ATP synthase represents a fundamental biological machine that could be re-engineered for novel functions in synthetic biology applications, such as creating cellular systems with altered energy currencies or coupling ATP synthesis to non-native processes.

Biopharmaceutical Production:
Improved understanding of ATP synthase regulation could inform strategies for enhancing energy availability in plant-based biopharmaceutical production systems, potentially increasing yields of therapeutic proteins or specialized metabolites.

Environmental Resilience:
The observed relationship between ATP synthase function and multiple stress tolerance mechanisms suggests that atpF engineering could contribute to developing plants with enhanced resilience to climate change impacts, including more frequent drought, temperature extremes, and altered light environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.