Recombinant Agrostis stolonifera Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock
Cat. No.
BT2053724
Source
in vitro E.coli expression system
Synonyms
cemA; Chloroplast envelope membrane protein
Quick Inquiry

Description

Overview of Recombinant cemA

Recombinant Agrostis stolonifera chloroplast envelope membrane protein (cemA) is a genetically engineered variant of the native cemA protein, produced in E. coli for research applications. This protein plays a critical role in chloroplast membrane integrity and transport processes . The recombinant form includes a His-tag for purification and structural studies .

Functional Insights

  • Membrane Transport: Integral to ion and metabolite exchange across the chloroplast envelope .

  • Stress Adaptation: Proteomic studies link cemA to heat stress responses in Agrostis roots, where chloroplast membrane proteins are critical for thermotolerance .

  • Male Sterility: Chloroplast genes, including cemA, influence male sterility in plants by altering thylakoid structure and ROS regulation .

Subcellular Localization

cemA is localized to the inner chloroplast envelope membrane, validated via immunodetection and proteomic profiling .

Recombinant Expression Workflow

  1. Cloning: cemA gene inserted into an E. coli expression vector with a His-tag.

  2. Purification: Affinity chromatography using Ni-NTA resins .

  3. Quality Control: Validated by SDS-PAGE (>85% purity) and mass spectrometry .

Key Challenges

  • Hydrophobicity: Requires organic solvents (e.g., chloroform/methanol) for extraction .

  • Stability: Lyophilization with trehalose preserves functionality during storage .

Functional Studies

  • Transport Mechanisms: Used to study metabolite exchange in chloroplasts .

  • Stress Response Models: Investigated in heat-tolerant Agrostis varieties to elucidate membrane protein dynamics under stress .

Comparative Analysis Across Species

SpeciesUniProt IDProtein LengthKey Features
Agrostis stoloniferaA1EA20230 aaThermotolerance-associated residues (e.g., FFYNLND motif)
Barbarea vernaA4QKB7229 aa90% sequence similarity; lacks heat-stress motifs
Nephroselmis olivaceaQ9TKZ2392 aaExtended C-terminal domain for algal adaptations

Future Directions

  • CRISPR Knockout Models: To validate cemA's role in chloroplast-nucleus communication.

  • Industrial Applications: Optimizing recombinant production for bioengineering stress-resistant crops.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage condition, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
cemA
Target Protein Sequence
MKKKKALPSLLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSETLLTDIQEKRILERF IELEELSLLDEMIKEKLKTHVQKPPIGIHKQIIQLVKIDNEDHLHIILHFSTNIICLAIL SGSFFLSKKELVIFNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELVIRWVYND LGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.
A1EA20

Target Background

Function
May be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.