Recombinant Agrostis stolonifera Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does PetD assembly affect cytochrome b6-f complex formation?

PetD assembly is prerequisite for proper cytochrome b6-f complex formation through a sequential assembly mechanism. Research demonstrates that PetD forms an initial subcomplex with cytochrome b6, which then serves as a scaffold for the assembly of cytochrome f and PetG . The absence of either PetD or cytochrome b6 significantly reduces the synthesis of cytochrome f, indicating their critical role in the assembly pathway . This hierarchical assembly process ensures proper complex formation and prevents the accumulation of potentially harmful assembly intermediates in the thylakoid membrane.

What are the genetic characteristics of PetD in Agrostis stolonifera?

While specific information on A. stolonifera's PetD gene sequence is limited, we can infer from the organism's genomic characteristics. A. stolonifera has a mitochondrial genome comprising three contiguous chromosomes totaling 560,800 bp with a GC content of 44.07% . The chloroplast genome, where PetD is typically located, would likely show conservation with related grass species. As a member of the Pooideae subfamily with close relationship to Lolium perenne , A. stolonifera's PetD gene likely exhibits similar sequence characteristics to its relatives, with species-specific variations that could affect protein interactions or complex stability.

What are the optimal conditions for expressing recombinant A. stolonifera PetD protein?

Table 1: Optimized Expression Conditions for Recombinant A. stolonifera PetD

ParameterRecommended ConditionNotes
Expression systemE. coli BL21(DE3)Alternative: Pichia pastoris for post-translational modifications
VectorpET-28a(+)Provides N-terminal His-tag for purification
Temperature16-18°CHigher temperatures increase inclusion body formation
Induction0.1-0.5 mM IPTGLow IPTG improves soluble protein yield
Post-induction time16-20 hoursExtended time improves yield at lower temperatures
Media supplements1% glucose, 5 mM MgSO₄Enhances membrane protein expression
Lysis buffer50 mM Tris-HCl pH 7.5, 300 mM NaCl, 5% glycerol, 1% DDMDetergent critical for membrane protein solubilization

For optimal expression of recombinant A. stolonifera PetD protein, a low-temperature induction protocol is recommended due to the membrane-associated nature of this protein. Expression should be conducted in E. coli strains optimized for membrane proteins, with careful consideration of detergent selection during purification to maintain protein stability and native folding. The inclusion of molecular chaperones (GroEL/GroES) as co-expression partners may significantly improve proper folding and reduce aggregation of this challenging protein.

How can researchers accurately quantify the interaction between PetD and DAC proteins?

The interaction between PetD and DAC proteins can be quantified using multiple complementary approaches. Surface plasmon resonance (SPR) provides real-time binding kinetics, yielding association (ka) and dissociation (kd) rate constants along with equilibrium dissociation constants (KD). For in vivo studies, bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET) can visualize interactions within intact chloroplasts. Isothermal titration calorimetry (ITC) offers thermodynamic parameters including enthalpy (ΔH), entropy (ΔS), and binding stoichiometry. Co-immunoprecipitation followed by western blotting provides semi-quantitative validation of interactions, while hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map specific interaction interfaces with amino acid-level resolution. The DAC protein appears to be a novel factor involved in cytochrome b6/f complex assembly or stabilization through potential interactions with the PetD protein .

What methodologies are most effective for studying PetD turnover in vivo?

Studying PetD turnover in vivo requires multiple approaches:

  • Pulse-chase analysis with radioisotope labeling: This method allows tracking of newly synthesized PetD through incorporation of radioactive amino acids (typically ³⁵S-methionine), followed by immunoprecipitation at various time points to determine protein half-life .

  • Fluorescent timer fusion proteins: Genetically fusing PetD to fluorescent proteins that change emission spectra over time provides real-time visualization of protein age in living cells.

  • Selective ribosome profiling: This technique allows measurement of translation efficiency and can help determine if reduced PetD accumulation results from decreased synthesis or increased degradation.

  • Inhibitor studies: Using protein synthesis inhibitors (cycloheximide) or proteasome inhibitors (MG132) helps distinguish between synthesis defects and degradation-related issues.

Previous research has shown that pulse labeling experiments can effectively track the synthesis and accumulation of PetD, with studies demonstrating reduced labeling of PetD in certain mutants such as dac .

How does PetD interact with other subunits of the cytochrome b6-f complex?

PetD interacts with multiple components of the cytochrome b6-f complex in a highly coordinated manner. It forms a primary interaction with cytochrome b6, creating a protease-resistant subcomplex that serves as a critical assembly intermediate . This subcomplex subsequently recruits cytochrome f and PetG to form a more complete cytochrome moiety . The assembly process continues with the addition of PetC and PetL to produce the functional dimeric complex. Notably, the stability of PetD is highly dependent on the presence of cytochrome b6, as PetD becomes unstable in its absence . These interactions involve both transmembrane domain associations and surface-exposed loop regions that facilitate proper complex assembly and stability.

What techniques can researchers use to identify novel interaction partners of A. stolonifera PetD?

Table 2: Techniques for Identifying Novel PetD Interaction Partners

TechniqueApplicationAdvantagesLimitations
AP-MS/BioIDUnbiased discovery of protein interactionsIdentifies entire interactome, works in vivoMay include indirect interactions
Yeast two-hybridDirect protein-protein interactionsHigh-throughput, relatively inexpensiveHigh false positive rate, membrane proteins challenging
Split-ubiquitin systemMembrane protein interactionsDesigned for membrane proteinsLimited to binary interactions
Co-IP with shotgun proteomicsVerification of complex componentsPreserves native conditionsRequires high-quality antibodies
Proximity labeling (APEX2/TurboID)Spatial proteomicsMaps proteins in close proximity in vivoRequires genetic modification of target organism
Crosslinking mass spectrometry (XL-MS)Interface mappingIdentifies interaction sites with resolutionComplex data analysis

For identifying novel interaction partners of A. stolonifera PetD, researchers should consider a multi-technique approach that combines the strengths of different methods. Initial screening using yeast two-hybrid or split-ubiquitin systems can identify candidate interactors, followed by validation through co-immunoprecipitation and proximity labeling in planta. Crosslinking mass spectrometry provides detailed interface information for validated interactions. Research has already identified DAC as a potential interaction partner of PetD involved in the assembly or stabilization of the cytochrome b6/f complex , suggesting other novel factors may remain to be discovered.

How can CRISPR-Cas9 be optimized for targeted modification of the PetD gene in A. stolonifera?

Table 3: CRISPR-Cas9 Optimization Parameters for PetD Modification in A. stolonifera

ParameterRecommended ApproachRationale
Cas9 variantPlant codon-optimized SpCas9 or high-fidelity variants (HiFi Cas9)Reduced off-target effects
Delivery methodAgrobacterium-mediated transformation or biolistic bombardmentEstablished methods for grass transformation
Promoter for Cas9Rice Ubiquitin promoter (rUbi)Strong, constitutive expression in monocots
sgRNA designTarget conserved regions, avoid regions with SNPsEnsures efficacy across varieties
PAM selectionNGG sites within first third of coding sequenceEarly disruption maximizes loss-of-function
sgRNA numberMultiple sgRNAs (2-3) targeting different regionsIncreases likelihood of successful editing
Selection markerHygromycin resistance (hpt II)Effective selection in creeping bentgrass
VerificationTargeted deep sequencing, protein immunoblottingConfirms both genetic and protein-level changes

What methods can be used to isolate and characterize PetD mutants in A. stolonifera?

Isolating and characterizing PetD mutants in A. stolonifera requires a comprehensive approach:

  • Mutant generation:

    • TILLING (Targeting Induced Local Lesions IN Genomes) using chemical mutagenesis (EMS)

    • Targeted mutagenesis via plastid transformation

    • Screening natural population variants

  • Phenotypic screening:

    • Chlorophyll fluorescence imaging (Fv/Fm, ΦPSII) to identify photosynthetic defects

    • Growth rate assessment under different light intensities

    • Herbicide sensitivity profiling (DCMU, DBMIB) to probe electron transport chain functionality

  • Molecular characterization:

    • Immunoblotting to assess PetD protein accumulation

    • Blue-native PAGE to analyze cytochrome b6-f complex assembly

    • RT-PCR and RNA gel blot analysis to measure PetD transcript levels

    • Sequencing to confirm mutations in the PetD gene

  • Biochemical analysis:

    • Spectroscopic measurements of cytochrome b6-f activity

    • Thylakoid membrane isolation and protein complex separation

    • Mass spectrometry to identify alterations in protein-protein interactions

Previous studies have successfully used pulse-chase labeling followed by immunoprecipitation to characterize the synthesis and accumulation of cytochrome b6-f complex subunits including PetD , providing a methodological foundation for further mutant characterization.

How does A. stolonifera PetD differ from orthologs in other grass species?

While specific sequence comparisons of A. stolonifera PetD with other grass species are not provided in the search results, we can draw inferences from evolutionary relationships. A. stolonifera belongs to the Pooideae subfamily and shows close phylogenetic relationship to Lolium perenne based on mitochondrial genome analysis . The PetD protein, being essential for photosynthesis, is generally highly conserved across plant species, particularly within related taxonomic groups.

Comparisons would likely reveal:

  • High sequence conservation in functional domains, particularly transmembrane helices and regions interacting with cytochrome b6

  • Species-specific variations in less functionally constrained regions, especially surface-exposed loops

  • Conservation of RNA editing sites, which are common in chloroplast genes

  • Similar gene organization and regulatory elements in the chloroplast genome

Phylogenetic analysis confirms A. stolonifera's placement within the Pooideae subfamily , suggesting its PetD protein would share highest similarity with close relatives like Lolium perenne, followed by other members of Poaceae, with increasing divergence in more distantly related plant families.

What evolutionary insights can be gained from studying PetD sequence conservation?

Studying PetD sequence conservation across plant lineages provides valuable evolutionary insights:

  • Functional constraints: Highly conserved regions indicate domains under strong selective pressure due to critical functional roles in electron transport or protein-protein interactions within the cytochrome b6-f complex.

  • Adaptation mechanisms: Lineage-specific variations may reflect adaptations to different environmental conditions, such as light intensity or temperature ranges relevant to A. stolonifera's ecological niche.

  • Co-evolutionary patterns: Correlated sequence changes between PetD and its interaction partners (like cytochrome b6) can reveal co-evolutionary constraints within multiprotein complexes.

  • RNA editing sites: The distribution and conservation of RNA editing sites across species can illuminate the evolution of post-transcriptional regulation mechanisms.

  • Horizontal gene transfer: Analysis of unusual sequence similarities might reveal rare instances of horizontal gene transfer between distantly related organisms.

The phylogenetic relationship of A. stolonifera to other Pooideae members provides context for understanding how PetD has evolved within this subfamily and how it compares to more distant relatives, offering insights into both conserved functions and species-specific adaptations.

How can researchers overcome challenges in expressing and purifying functional recombinant PetD protein?

Expressing and purifying functional recombinant PetD protein presents several challenges due to its membrane-associated nature. Researchers can implement the following strategies:

  • Expression system optimization:

    • Use specialized E. coli strains designed for membrane proteins (C41/C43, Lemo21)

    • Consider cell-free expression systems that provide better control over the membrane mimetic environment

    • For eukaryotic post-translational modifications, Pichia pastoris or insect cell systems may yield better results

  • Fusion tags and partners:

    • N-terminal fusion with MBP (maltose-binding protein) or SUMO can improve solubility

    • C-terminal GFP fusion serves as a folding indicator

    • Co-expression with natural binding partners (cytochrome b6) may stabilize the protein

  • Solubilization and purification:

    • Screen detergents systematically (DDM, LMNG, GDN) for optimal extraction

    • Consider nanodisc or amphipol reconstitution for maintaining native-like lipid environment

    • Use affinity chromatography followed by size exclusion under optimized buffer conditions

  • Functional validation:

    • Circular dichroism to confirm secondary structure

    • Binding assays with known interaction partners

    • Reconstitution experiments with other cytochrome b6-f complex components

Previous research has demonstrated that PetD forms a protease-resistant subcomplex with cytochrome b6 , suggesting co-expression of these proteins might improve stability and functional yield of recombinant PetD.

What are the main pitfalls in studying PetD-protein interactions and how can they be addressed?

Table 4: Common Pitfalls in PetD Interaction Studies and Mitigation Strategies

PitfallManifestationMitigation Strategy
Non-specific bindingFalse positive interactionsInclude appropriate controls (GST, non-related membrane proteins)
Detergent interferenceLoss of weak interactionsScreen multiple detergents, consider detergent-free systems (nanodiscs)
Transient interactionsMissed binding eventsUse chemical crosslinking or rapid kinetic methods
Improper protein foldingLoss of binding capacityValidate protein structure before interaction studies
Indirect interactionsMisinterpretation of direct bindingUse techniques that distinguish direct vs. indirect interactions
Buffer incompatibilityReduced binding activityOptimize ionic strength, pH, and divalent cations
Post-translational modificationsAltered binding propertiesUse expression systems that maintain relevant modifications
Membrane environmentAltered protein conformationReconstitute in native-like lipid environments

When studying interactions involving PetD, it's crucial to consider its membrane-associated nature and its participation in a multi-protein complex. The DAC protein has been identified as potentially interacting with PetD in the assembly or stabilization of the cytochrome b6/f complex , highlighting the importance of careful experimental design to detect authentic interactions. Multiple complementary techniques should be employed to validate interactions, and studies should include both in vitro and in vivo approaches to comprehensively characterize the interaction landscape.

How can understanding PetD function in A. stolonifera contribute to crop improvement strategies?

Understanding PetD function in Agrostis stolonifera has several potential applications for crop improvement:

These applications extend beyond A. stolonifera to other economically important crops, particularly other grasses in the Pooideae subfamily with which A. stolonifera shares close phylogenetic relationships .

What are promising future research directions for studying recombinant A. stolonifera PetD?

Future research on recombinant A. stolonifera PetD should focus on several promising directions:

  • High-resolution structural studies: Obtaining crystal structures or cryo-EM reconstructions of A. stolonifera cytochrome b6-f complex would provide valuable insights into species-specific features and interaction interfaces involving PetD.

  • Systems biology approaches: Integrating transcriptomics, proteomics, and metabolomics data to understand how PetD expression and assembly are regulated in different environmental conditions and developmental stages.

  • Synthetic biology applications: Engineering optimized versions of PetD with enhanced stability or altered regulatory properties could lead to improved photosynthetic efficiency.

  • Comparative genomics across ecotypes: Studying natural variation in PetD sequences and expression patterns across different A. stolonifera ecotypes could reveal adaptive mechanisms to diverse environmental conditions.

  • Investigation of novel interaction partners: Building on discoveries like the DAC protein's involvement in cytochrome b6-f complex assembly , identifying and characterizing other factors that interact with PetD would enhance our understanding of photosynthetic complex assembly and regulation.

  • Development of biosensors: Leveraging PetD interactions to develop biosensors for monitoring electron transport efficiency or detecting specific environmental stressors in real-time.

These research directions would not only advance fundamental understanding of photosynthetic processes but could also lead to practical applications in agriculture, bioenergy, and environmental monitoring.

What are the most reliable protocols for isolating and characterizing the cytochrome b6-f complex from A. stolonifera?

The isolation and characterization of cytochrome b6-f complex from A. stolonifera requires careful handling to maintain structural integrity and functional activity. The following protocol outline provides a reliable approach:

Isolation Protocol:

  • Thylakoid membrane preparation:

    • Harvest fresh leaf tissue (50-100g) and homogenize in grinding buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 5 mM MgCl₂, 10 mM NaCl, 2 mM EDTA)

    • Filter through miracloth and centrifuge at 1,000 × g for 5 min to remove debris

    • Collect chloroplasts by centrifugation at 3,000 × g for 10 min

    • Osmotically lyse chloroplasts and collect thylakoids by centrifugation at 10,000 × g for 10 min

  • Detergent solubilization:

    • Resuspend thylakoids to 1 mg chlorophyll/mL in solubilization buffer (30 mM Tricine-NaOH pH 8.0, 5 mM MgCl₂)

    • Add n-dodecyl-β-D-maltoside to 1% (w/v) and incubate on ice for 30 min

    • Remove insoluble material by centrifugation at 20,000 × g for 30 min

  • Sucrose gradient ultracentrifugation:

    • Layer solubilized sample onto 0.1-1.0 M sucrose gradient containing 0.03% DDM

    • Centrifuge at 200,000 × g for 16 hours at 4°C

    • Collect the cytochrome b6-f complex band (typically at ~0.5 M sucrose)

  • Ion exchange chromatography:

    • Further purify using DEAE or Q-Sepharose column

    • Elute with linear gradient of 0-500 mM NaCl

Characterization Methods:

  • Spectroscopic analysis:

    • Absorption spectra (400-700 nm) to detect characteristic peaks of cytochromes

    • Redox difference spectra (reduced minus oxidized) to confirm cytochrome content

  • Activity assays:

    • Plastohydroquinone-plastocyanin oxidoreductase activity

    • Cytochrome c reduction assay using artificial electron donors

  • Protein composition analysis:

    • SDS-PAGE followed by immunoblotting for PetD and other subunits

    • Mass spectrometry for detailed subunit identification

This protocol has been adapted from established methods for cytochrome b6-f complex isolation from other plant species, with modifications based on pulse-chase labeling experiments that have successfully tracked the synthesis and assembly of complex components including PetD .

Where can researchers access A. stolonifera genetic resources and research tools?

Researchers interested in A. stolonifera genetic resources and research tools can access various repositories and databases:

Genetic Resources:

  • GRIN (Germplasm Resources Information Network)

  • USDA National Plant Germplasm System

    • Preserves diverse A. stolonifera germplasm

    • Provides seeds for research purposes

  • European Cooperative Programme for Plant Genetic Resources

    • Contains European accessions of A. stolonifera

Genomic Resources:

  • NCBI GenBank

    • Contains mitochondrial genome sequences of A. stolonifera

    • Includes chloroplast genome data and gene sequences

  • Phytozome

    • Comparative genomics platform for plant research

    • Contains genomic data for related grass species

  • GrainGenes

    • Database for Triticeae and Avena species, including related Poaceae

Research Tools:

  • Turfgrass Information Center (Michigan State University)

    • Comprehensive collection of turfgrass research literature

    • Includes A. stolonifera-specific publications

  • TAIR (The Arabidopsis Information Resource)

    • While focused on Arabidopsis, provides tools applicable to A. stolonifera research

    • Offers protocols adaptable to grass species

  • Monsanto/Scotts Regulatory Information

    • Documentation on genetically engineered A. stolonifera (event ASR368)

    • Provides information on transformation protocols

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.