Recombinant Agrostis stolonifera Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store aliquots at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFSSVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Agrostis stolonifera and why is it significant in plant molecular biology?

Agrostis stolonifera (creeping bentgrass) is a mat-forming grass with stoloniferous growth habit that belongs to the Pooideae subfamily. It is an allotetraploid (2n = 4x = 28) cool-season turfgrass widely used on golf courses due to its tolerance to low mowing and aggressive growth patterns . The species is characterized by sprawling stoloniferous growth that roots at nodes, forming dense mats or turf 30-60 cm tall, sometimes growing submerged in fast-flowing water .

From a research perspective, A. stolonifera is significant because:

  • It serves as a model system for polyploid grass genomics

  • It demonstrates unique adaptations to various environmental conditions

  • Its genome exhibits interesting evolutionary relationships with other Pooideae species

  • It has proven amenable to genetic transformation techniques

What is the function of Cytochrome b6 (petB) in photosynthetic organisms?

Cytochrome b6 (encoded by the petB gene) is a critical component of the Cytochrome b6-f complex located in thylakoid membranes of chloroplasts. This complex serves as the electronic connection between Photosystem II and Photosystem I in the photosynthetic electron transport chain. While our search results don't specifically detail Cytochrome b6 function, research on related components like Cytochrome b6-f complex subunit 4 (petD) indicates the complex's essential role in:

  • Facilitating electron transfer between photosystems

  • Contributing to the generation of proton gradient across thylakoid membranes

  • Enabling cyclic electron flow around Photosystem I

  • Influencing regulation of state transitions between photosystems

The protein structure typically contains transmembrane domains that anchor it within the thylakoid membrane, allowing it to perform its electron transport functions effectively.

How does the genomic organization of Agrostis stolonifera influence cytochrome gene expression?

Comparative genomic analyses reveal that A. stolonifera exhibits distinctive genomic organization compared to other Pooideae members. Research has shown large-scale chromosomal rearrangements on different linkage groups (LGs) of creeping bentgrass relative to the Triticeae (3 LGs), oat (4 LGs), and rice (8 LGs) . Interestingly, no chromosomal rearrangements were detected between creeping bentgrass and ryegrass, suggesting close evolutionary relationships despite belonging to different Pooideae tribes .

These genomic structures likely influence cytochrome gene expression through:

  • Altered promoter contexts affecting transcriptional regulation

  • Modified chromatin structures impacting accessibility of transcription factors

  • Potentially different copy numbers of genes due to its allotetraploid nature

  • Changed syntenic relationships that may affect co-expression patterns

Analysis comparing A. stolonifera with Brachypodium distachyon identified 24 syntenic blocks based on 678 orthologous loci, providing insight into evolutionary conservation of gene order that may affect expression patterns of photosynthetic genes including petB .

What expression systems are most effective for recombinant production of Agrostis stolonifera Cytochrome b6?

Based on successful expression of related proteins from A. stolonifera, E. coli represents an effective heterologous expression system for recombinant production of chloroplast proteins like Cytochrome b6. Evidence from the expression of Cytochrome b6-f complex subunit 4 (petD) indicates that bacterial expression with appropriate tags (such as His-tag) enables efficient purification and recovery of functional protein .

Table 1: Comparison of Expression Systems for Recombinant Photosynthetic Proteins

Expression SystemAdvantagesLimitationsSuitability for Cyt b6
E. coliRapid growth, high yield, established protocolsLacks post-translational modifications, potential inclusion body formationHigh with optimized conditions
Yeast systemsSome eukaryotic PTMs, moderate yieldHigher cost, longer production timeModerate
Plant cell culturesNative-like PTMs, proper foldingLow yield, technical complexityHigh but resource-intensive
Cell-free systemsRapid, avoids toxicity issuesExpensive, lower yieldGood for functional studies

When expressing Cytochrome b6 in E. coli, researchers should consider:

  • Using N-terminal His-tags for purification as demonstrated with petD protein

  • Optimizing codon usage for prokaryotic expression

  • Including solubility-enhancing fusion partners if membrane integration proves challenging

  • Employing specialized E. coli strains designed for membrane protein expression

How can Agrobacterium-mediated transformation be optimized for studying Cytochrome b6 function in Agrostis stolonifera?

Agrobacterium tumefaciens-mediated transformation has been successfully established for A. stolonifera with efficiency ranging from 18% to 45% . This approach offers significant advantages for studying native Cytochrome b6 function through gene editing, promoter analysis, or overexpression studies.

The optimized protocol involves:

  • Initiating embryogenic callus from seeds (cv. Penn-A-4)

  • Infecting callus with A. tumefaciens strain LBA4404 harboring appropriate vectors

  • Using strong constitutive promoters such as CaMV 35S or rice ubiquitin promoters

  • Including selection markers (e.g., herbicide-resistant bar gene)

  • Regenerating plants from transformed callus

This methodology typically results in 60-65% of transformations containing only a single copy of the foreign gene with no apparent rearrangements, which is ideal for functional studies as it minimizes position effects and complex integration patterns . For studying Cytochrome b6 specifically, researchers could use this system to:

  • Create knockout/knockdown lines to assess functional importance

  • Introduce tagged versions for localization or interaction studies

  • Perform promoter-reporter fusions to study expression patterns

  • Engineer site-directed mutations to analyze structure-function relationships

What considerations are important when isolating and characterizing the native petB gene from Agrostis stolonifera?

When isolating the native petB gene from A. stolonifera, researchers should consider several factors stemming from its allotetraploid nature (2n = 4x = 28) and unique genome organization:

  • Genome Complexity: As an allotetraploid, A. stolonifera likely contains multiple copies or homeologs of petB that may have diverged functionally .

  • Primer Design: Design should account for potential sequence variations between homeologs by targeting highly conserved regions, possibly informed by comparative analysis with related Pooideae species.

  • EST Resources: Utilizing the 8,470 publicly available A. stolonifera ESTs (AgEST) can facilitate gene isolation and characterization .

  • Phylogenetic Context: Consider the evolutionary relationships revealed through comparative genomics when interpreting sequence data, particularly the close relationship with ryegrass despite different tribal classifications .

  • Chloroplast vs. Nuclear Genome: While many photosynthetic genes have been transferred to the nuclear genome during evolution, determining whether petB remains chloroplast-encoded in A. stolonifera is essential for isolation strategy.

For characterization of isolated genes, researchers should consider using the EST orthologs identified in comparative mapping of Pooideae species, which can provide evolutionary context to functional studies .

What purification techniques are most effective for recombinant Cytochrome b6 from Agrostis stolonifera?

Based on successful purification strategies for related membrane proteins like Cytochrome b6-f complex subunit 4 (petD), the following purification approach is recommended:

  • Affinity Chromatography: Utilizing N-terminal His-tag for immobilized metal affinity chromatography (IMAC) as the primary purification step .

  • Buffer Optimization: Employing Tris/PBS-based buffers at pH 8.0 with the addition of stabilizers such as trehalose (6%) to maintain protein integrity during purification .

  • Membrane Protein Considerations: Including appropriate detergents during extraction and purification to maintain the native conformation of this membrane-associated protein.

  • Quality Assessment: Confirming purity greater than 90% using techniques such as SDS-PAGE .

  • Final Preparation: Lyophilization as a final form allows for long-term storage and easy reconstitution .

What are the optimal storage conditions for maintaining activity of recombinant Cytochrome b6?

Optimal storage conditions for maintaining the structural integrity and functional activity of recombinant Cytochrome b6 based on protocols for similar proteins include:

  • Temperature: Store at -20°C/-80°C upon receipt, with working aliquots maintained at 4°C for up to one week .

  • Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity .

  • Cryoprotectants: Add 5-50% glycerol (final concentration) before freezing to prevent ice crystal formation and protein denaturation, with 50% being a standard recommendation .

  • Reconstitution: When needed, reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage Buffer: Maintain in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to enhance stability during storage .

How can researchers validate the functional integrity of recombinant Cytochrome b6 protein?

Validation of functional integrity for recombinant Cytochrome b6 protein requires multiple complementary approaches:

  • Spectroscopic Analysis:

    • UV-visible absorption spectroscopy to confirm characteristic peaks at ~553 nm (reduced) and ~563 nm (oxidized)

    • Circular dichroism to assess secondary structure integrity

    • Fluorescence spectroscopy to evaluate tertiary structure

  • Electron Transfer Activity:

    • Measurement of electron transfer rates using artificial electron donors and acceptors

    • Reconstitution assays with other components of the photosynthetic electron transport chain

  • Structural Validation:

    • Size exclusion chromatography to confirm appropriate oligomeric state

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine stability profiles

  • Binding Studies:

    • Interaction analysis with known protein partners from the Cytochrome b6-f complex

    • Ligand binding assays to confirm cofactor association (heme groups)

How does the genome structure of Agrostis stolonifera influence the evolution of photosynthetic genes?

Research on A. stolonifera genome structure reveals significant insights into evolutionary patterns affecting photosynthetic genes:

  • Chromosomal Rearrangements: Comparative genome analysis demonstrates large-scale chromosomal rearrangements between A. stolonifera and other Pooideae members except ryegrass. These rearrangements were identified on different numbers of linkage groups: Triticeae (3 LGs), oat (4 LGs), rice (8 LGs), and Brachypodium distachyon (6 LGs) .

  • Syntenic Blocks: Analysis identified 24 syntenic blocks based on 678 orthologous loci between A. stolonifera and B. distachyon, suggesting conservation of certain gene clusters through evolution despite rearrangements .

  • Allotetraploidy Effects: As an allotetraploid (2n = 4x = 28), A. stolonifera has undergone genome doubling events that likely influenced photosynthetic gene evolution through:

    • Potential subfunctionalization of duplicated genes

    • Increased genetic redundancy allowing evolutionary experimentation

    • Altered expression patterns due to dosage effects

  • Tribal Relationships: Despite being classified in different Pooideae tribes, A. stolonifera and ryegrass show no detected chromosomal rearrangements, suggesting they may be more closely related than previously thought . This evolutionary proximity may explain conservation patterns in photosynthetic gene complexes.

These genomic features provide context for understanding the evolution of complex chloroplast proteins like Cytochrome b6 and may explain functional adaptations specific to A. stolonifera.

What approaches can resolve structural determinants of Cytochrome b6 from Agrostis stolonifera?

Resolving the structural determinants of Cytochrome b6 from A. stolonifera requires multiple complementary approaches:

  • Homology Modeling: Using the amino acid sequence (inferred from the petB gene) to build structural models based on known structures of Cytochrome b6 from other species. The sequence of related proteins like petD (MGVTKKPDLNDPVLRAKLAKGMGHNYY...) can provide insights into typical sequence features of electron transport proteins from this species .

  • Protein Crystallography: Production of purified recombinant protein using methods similar to those employed for petD protein, followed by crystallization trials and X-ray diffraction analysis.

  • Cryo-Electron Microscopy: An alternative to crystallography, particularly useful for membrane protein complexes, allowing visualization of the protein in a more native-like environment.

  • Structure-Function Analysis: Site-directed mutagenesis of conserved residues to determine their contribution to function, especially those involved in:

    • Heme binding

    • Interface contacts with other subunits

    • Transmembrane regions

    • Electron transfer pathways

  • Molecular Dynamics Simulations: Computational analysis of protein dynamics within a simulated membrane environment to understand conformational changes during electron transport.

How can gene editing technologies be applied to study Cytochrome b6 function in Agrostis stolonifera?

The established Agrobacterium-mediated transformation system for A. stolonifera provides a foundation for applying modern gene editing technologies to study Cytochrome b6 function:

  • CRISPR/Cas9 Gene Editing: Building on the successful transformation protocol (18-45% efficiency) , CRISPR/Cas9 vectors can be introduced to create:

    • Knockout mutants to assess essentiality and physiological impact

    • Point mutations to analyze specific amino acid contributions to function

    • Tagged versions for localization and interaction studies

  • Base Editing: More precise than traditional CRISPR/Cas9, allowing conversion of specific nucleotides without double-strand breaks, useful for subtle modifications to study structure-function relationships.

  • Promoter Manipulation: Modification of native promoter elements to study regulation of petB expression under different environmental conditions.

  • Integration Considerations: The observation that 60-65% of A. stolonifera transformants contain single-copy transgene insertions suggests that clean gene editing events with minimal off-target effects are achievable.

  • Screening Strategy: Selection systems using herbicide resistance markers (e.g., bar gene) that have proven effective in A. stolonifera transformation can be adapted for identifying successful gene editing events.

What statistical approaches are recommended for analyzing electron transport measurements of recombinant versus native Cytochrome b6?

When comparing electron transport measurements between recombinant and native Cytochrome b6, researchers should consider these statistical approaches:

  • Experimental Design Considerations:

    • Nested design accounting for biological replicates (different protein preparations) and technical replicates

    • Blocking factors to account for measurement day/instrument variability

    • Inclusion of appropriate controls (denatured protein, known inhibitors)

  • Comparative Analysis Methods:

    • Paired t-tests for direct comparisons of key parameters (Vmax, Km)

    • ANOVA for multi-factor experiments examining effects of pH, temperature, etc.

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) if normality assumptions are violated

  • Kinetic Data Analysis:

    • Non-linear regression for fitting electron transport data to appropriate kinetic models

    • Akaike Information Criterion (AIC) for model selection between competing kinetic mechanisms

    • Bootstrap resampling to generate confidence intervals for kinetic parameters

  • Visualization Approaches:

    • Enzyme kinetic plots (Michaelis-Menten, Lineweaver-Burk)

    • Box plots showing distribution of replicate measurements

    • Principal component analysis for multi-parameter comparisons

  • Power Analysis:

    • A priori determination of sample sizes needed to detect biologically meaningful differences

    • Post-hoc power analysis to interpret negative results

How can researchers address potential artifacts in recombinant protein studies of Cytochrome b6?

Researchers should systematically address potential artifacts when working with recombinant Cytochrome b6:

What approaches can resolve contradictory results in Cytochrome b6 functional studies?

When confronted with contradictory results in functional studies of Cytochrome b6, researchers should implement the following resolution approaches:

  • Methodological Standardization:

    • Establish consistent protocols for protein preparation, storage, and assay conditions

    • Create standard reference materials that can be shared between laboratories

    • Implement blind testing protocols to eliminate experimenter bias

  • Multi-Parameter Analysis:

    • Expand assays beyond primary functional measurements to include:

      • Structural integrity indicators

      • Post-translational modification assessment

      • Cofactor binding stoichiometry

    • Use correlation analysis between parameters to identify sources of variation

  • Computational Modeling:

    • Develop mechanistic models that can predict the impact of experimental variables

    • Use sensitivity analysis to identify which parameters most strongly influence outcomes

    • Implement machine learning approaches to identify patterns in complex datasets

  • Collaborative Resolution:

    • Organize inter-laboratory comparison studies with standardized materials

    • Implement sequential experimental designs where each lab builds on previous findings

    • Create centralized databases of raw data to enable meta-analysis

  • Biological Context:

    • Consider how the allotetraploid nature of A. stolonifera might result in naturally occurring isoforms with different properties

    • Examine how findings compare to related species, particularly ryegrass which shows close genomic similarity

    • Evaluate environmental adaptation hypotheses that might explain functional differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.