Recombinant Agrostis stolonifera Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Agrostis stolonifera Cytochrome c biogenesis protein ccsA (ccsA) is a 319-amino-acid polypeptide (UniProt ID: A1EA58) expressed in E. coli with an N-terminal His tag for purification . This protein belongs to the CcmF/CycK/Ccl1/NrfE/CcsA family, critical for heme attachment during cytochrome c maturation in chloroplasts .

Functional Role

CcsA facilitates heme ligation to apocytochromes c6 and f in Agrostis stolonifera chloroplasts, enabling electron transport in photosynthesis . Its multi-pass membrane localization in thylakoid membranes underscores its role in redox processes.

Key Findings:

  • RNA Editing: The mitochondrial genome of A. stolonifera reveals extensive RNA editing (460 sites), optimizing cytochrome assembly efficiency .

  • Codon Usage Bias: Strong preference for GCU (alanine) and CAA (glutamine), with weak bias for cysteine and phenylalanine codons .

Research Use Cases

  • Herbicide Resistance Studies: Used to investigate risks of glyphosate-tolerant GM creeping bentgrass spreading to wild populations .

  • Heme Attachment Mechanisms: Serves as a model for studying system II cytochrome c maturation pathways in plants .

Industrial Relevance

  • Protein Interaction Studies: Commercial variants (≥85% purity via SDS-PAGE) enable structural analyses of heme-protein binding .

  • Turfgrass Disease Resistance: Linked to fungal membrane disruption in studies of Clarireedia jacksonii infections .

Table 2: Production Parameters

ParameterSpecification
Host SystemsE. coli, yeast, baculovirus
Purity≥85% (SDS-PAGE verified)
Storage BufferTris/PBS with 6% trehalose or 50% glycerol
StabilityStable at -80°C; avoid freeze-thaw cycles

Table 3: Cross-Species Homology

SpeciesGene NameProtein FunctionHost System Used
Synechococcus sp.ccmC/ccsACytochrome c biogenesis permease E. coli
Lolium perenneccsAChloroplast heme attachment Yeast
Ceratophyllum demersumccsAHeme ligation in aquatic plants Mammalian

Challenges and Innovations

  • Genetic Engineering Risks: Horizontal gene transfer from GM A. stolonifera to wild relatives remains a concern due to wind pollination .

  • Structural Complexity: Branched mitochondrial genome (560.8 kbp) complicates functional genomics studies .

Future Directions

  • CRISPR-Based Studies: Targeting RNA editing sites to optimize cytochrome c assembly efficiency.

  • Ecological Impact Models: Assessing long-term effects of recombinant ccsA-expressing turfgrasses in natural ecosystems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
ccsA
Target Protein Sequence
MLFATLEHILTHISFSTISIVITIHLITLLVRELGGLRDSSEKGMIVTFFSITGFLVSRW ASSGHFPLSNLYESLIFLSWALYILHTIPKIQNSKNDLSTITTPSTILTQGFATSGLLTE MHQSTILVPALQSQWLMMHVSMMLLSYATLLCGSLLSAAILIIRFRNNFHFFSKKKKNVL HKTFLFSDFYAKRSALKSTSVPSFPNYYKYQLTERLDSWSYRVISLGFTLLTIGILCGAV WANEAWGSYWNWDPKETWAFITWTIFAIYLHSRTNQNWKGTNSALVASIGFLIIWICYFG INLLGIGLHSYGSFTLTPK
Uniprot No.

Target Background

Function
CcsA plays a crucial role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) during the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the ccsA gene in Agrostis stolonifera and what is its role in cytochrome c biogenesis?

The ccsA gene in Agrostis stolonifera encodes a membrane-bound protein that functions as a critical component of the cytochrome c biogenesis System II (Ccs system). CcsA, sometimes referred to as ResC in other organisms, works in conjunction with CcsB (ResB) to form the cytochrome c synthase complex . This complex is responsible for the stereospecific covalent attachment of heme to the apocytochrome via thioether bonds, a crucial post-translational modification process .

In plant chloroplasts, including those of A. stolonifera, CcsA is specifically involved in the transmembrane transport of heme b and participates in the process of attaching this heme to cysteine residues in the heme c attachment motif of apocytochromes . This process is essential for the proper functioning of the photosynthetic electron transport chain and, consequently, for plant growth and development.

Where is the ccsA gene located in the chloroplast genome of Agrostis stolonifera?

The ccsA gene in A. stolonifera is located in the chloroplast genome, specifically within the small single-copy (SSC) region. Based on comparative analysis with related grass species like Deschampsia antarctica, we can infer that the gene is positioned within the typical quadripartite structure of the chloroplast genome, which consists of a large single-copy region (LSC), a small single-copy region (SSC), and two inverted repeat regions (IR) .

The exact position and orientation of the ccsA gene in A. stolonifera may show some variation compared to other grass species, given that interspecific variability has been observed in the region between rbcL and psaI genes across different Poaceae members . Gene order and synteny analyses across chloroplast genomes of related species can help precisely locate the ccsA gene in A. stolonifera.

How conserved is the ccsA gene across different plant species compared to A. stolonifera?

The ccsA gene shows a considerable degree of conservation across plant species, reflecting its essential function in cytochrome c biogenesis. Sequence analysis reveals that genes involved in fundamental processes like photosynthesis and electron transport tend to be more highly conserved than genes with more specialized functions.

The table below presents a hypothetical comparison of ccsA gene sequence identity between A. stolonifera and selected grass species:

SpeciesSequence Identity (%)Functional Domain Conservation
Festuca arundinacea93-95High in heme-binding domains
Lolium perenne92-94High in transmembrane regions
Brachypodium distachyon89-91High in catalytic sites
Hordeum vulgare87-89Moderate variation in loop regions
Triticum aestivum86-88Moderate variation in N-terminal region
Deschampsia antarctica84-86Variation in non-catalytic domains

How is ccsA gene expression regulated in A. stolonifera chloroplasts?

The expression of the ccsA gene in A. stolonifera chloroplasts is likely regulated through multiple mechanisms similar to those observed in other chloroplast genes. Based on the transcriptome profiles of chloroplast genes in related species like Deschampsia antarctica, we can infer that:

  • The expression levels of ccsA are generally moderate compared to highly expressed photosynthetic genes such as psbA, psbJ, and ndhC

  • Regulation occurs at both transcriptional and post-transcriptional levels

  • Small non-coding RNAs (sRNAs) may play a role in regulating ccsA expression

  • RNA editing events might modify the ccsA transcript, altering the protein sequence and function

Chloroplast gene expression is often influenced by environmental factors such as light intensity, temperature, and stress conditions. Given A. stolonifera's adaptation to diverse habitats ranging from moist areas to wetlands , the regulation of ccsA expression might show environmental responsiveness.

What experimental approaches are recommended for recombinant expression of ccsA from A. stolonifera?

For successful recombinant expression of the ccsA gene from A. stolonifera, researchers should consider the following comprehensive approach:

Expression System Selection:

  • Bacterial systems (E. coli): Suitable for initial expression attempts but may result in inclusion bodies due to the membrane protein nature of CcsA

  • Yeast systems (P. pastoris): Better for membrane proteins with proper folding capacity

  • Plant-based expression systems: Consider tobacco or Arabidopsis transient expression for maintaining native folding environment

Optimization Protocol:

  • Gene synthesis with codon optimization for the chosen expression host

  • Design of constructs with solubility-enhancing fusion partners (MBP, SUMO, or Trx tags)

  • Inclusion of appropriate affinity tags (His6, FLAG, or Strep-II) for purification

  • Expression testing under varied induction conditions (temperature, inducer concentration, duration)

For membrane protein CcsA, detergent screening is critical. Begin with a panel of detergents including mild options (DDM, LMNG) and progress to more stringent ones (OG, LDAO) if necessary. Successful expression can be monitored through Western blotting targeting the affinity tag, while protein functionality can be assessed through in vitro cytochrome c maturation assays measuring heme attachment efficiency.

How can researchers effectively analyze protein-protein interactions involving CcsA in the cytochrome c biogenesis system?

To effectively analyze protein-protein interactions involving CcsA in A. stolonifera, researchers should employ a multi-technique approach:

In vivo techniques:

  • Split-GFP/BiFC (Bimolecular Fluorescence Complementation): Particularly useful for visualizing CcsA interactions with CcsB to form the cytochrome c synthase complex

  • Co-immunoprecipitation: For detecting native complexes in chloroplast extracts

  • FRET/FLIM: For studying dynamic interactions in intact chloroplasts

In vitro techniques:

  • Pull-down assays: Using recombinant tagged CcsA to identify interaction partners

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics between CcsA and potential partners

  • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of interactions

Crosslinking approaches:

  • Chemical crosslinking coupled with mass spectrometry: To capture transient interactions

  • Photo-affinity labeling: For mapping interaction interfaces

A systematic interaction mapping should focus first on known System II components (CcsB, CcdA, and CcsX) before expanding to potential novel interactors. The membrane-embedded nature of CcsA requires careful optimization of solubilization conditions that maintain protein structure while allowing detection of interactions.

What are the main challenges in studying CcsA function in A. stolonifera and how can they be addressed?

Studying CcsA function in A. stolonifera presents several significant challenges:

Challenge 1: Expression of a membrane protein

  • Solution: Use specialized expression systems designed for membrane proteins, such as cell-free systems supplemented with lipids or expression in lipid nanodiscs to maintain native conformation

Challenge 2: Limited natural abundance

  • Solution: Develop sensitive detection methods using targeted proteomics approaches (SRM/MRM-MS) to quantify native CcsA levels

Challenge 3: Functional assays in vitro

  • Solution: Develop reconstituted systems combining purified components (CcsA, CcsB, heme, and apocytochrome) in liposomes to measure heme attachment activity

Challenge 4: Genetic manipulation in A. stolonifera

  • Solution: Establish chloroplast transformation protocols specific for A. stolonifera, potentially adapting methods used in other grasses, or use heterologous systems to study function

Challenge 5: Distinguishing CcsA function from other cytochrome maturation components

  • Solution: Design experimental systems where individual components can be selectively inhibited or replaced, possibly utilizing CcsBA fusion proteins from ε-proteobacteria as experimental tools

Each challenge requires a specific methodological approach, often combining techniques from molecular biology, biochemistry, and structural biology to build a comprehensive understanding of CcsA function.

How do environmental stresses affect CcsA expression and function in A. stolonifera?

A. stolonifera (creeping bentgrass) inhabits diverse environments ranging from riparian areas to salt marshes and can be found in both wetlands and non-wetlands . This environmental adaptability suggests that cytochrome biogenesis, including CcsA function, may be modulated under different stress conditions.

Experimental approaches to assess stress responses:

Environmental StressRecommended Analysis MethodsExpected CcsA Response
DroughtRT-qPCR, Western blot, RNA-seqPossible upregulation to maintain electron transport efficiency
Salt stressProteomics, Activity assaysPotential post-translational modifications affecting function
Temperature extremesPulse-chase labeling, Protein stability assaysChanges in protein turnover rate and complex stability
HypoxiaOxygen consumption assays, Redox state analysisAltered electron flow through cytochrome pathway
Light stressChlorophyll fluorescence, Thylakoid isolationModified integration of cytochromes into photosystems

For comprehensive analysis, researchers should combine transcriptomic, proteomic, and metabolomic approaches to track changes in cytochrome c biogenesis under stress conditions. Additionally, comparing CcsA responses in A. stolonifera with those in related species from different ecological niches (such as Deschampsia antarctica, which thrives in extreme cold) can provide insights into evolutionary adaptations of the cytochrome c biogenesis system.

What isolation protocols yield the highest quality recombinant CcsA protein from A. stolonifera?

For optimal isolation of recombinant CcsA protein from A. stolonifera, a specialized extraction and purification protocol is recommended:

Step-by-Step Isolation Protocol:

  • Chloroplast Isolation

    • Harvest young leaf tissue (10-14 days post-germination)

    • Homogenize in isolation buffer (0.33M sorbitol, 50mM HEPES-KOH, pH 7.6, 2mM EDTA, 1mM MgCl₂, 1mM MnCl₂)

    • Purify chloroplasts through Percoll gradient centrifugation

  • Membrane Protein Extraction

    • Lyse chloroplasts by osmotic shock

    • Separate thylakoid membranes by centrifugation

    • Solubilize membranes with optimized detergent mixture (1% digitonin + 0.5% DDM)

  • Affinity Purification

    • Apply solubilized extract to appropriate affinity resin (based on tag used)

    • Implement stepwise washing with decreasing detergent concentrations

    • Elute protein using competition or tag cleavage

  • Quality Assessment

    • Validate purity by SDS-PAGE and immunoblotting

    • Confirm functional integrity through heme binding assays

    • Assess oligomeric state by size exclusion chromatography

For heterologous expression systems, additional considerations include codon optimization for the expression host, fusion with solubility-enhancing tags, and careful temperature control during expression (typically 16-18°C) to minimize inclusion body formation. The use of specialized E. coli strains (such as C41/C43) designed for membrane protein expression can significantly improve yields.

How can researchers effectively validate the function of recombinant CcsA in vitro?

Validating the function of recombinant CcsA requires assessing its ability to participate in cytochrome c maturation. The following methodological approach is recommended:

Functional Validation Workflow:

  • Heme Binding Assay

    • Incubate purified CcsA with heme

    • Detect binding through spectroscopic methods (absorption peak at ~412 nm)

    • Quantify affinity using isothermal titration calorimetry

  • Reconstitution of CcsA-CcsB Complex

    • Co-express or combine purified CcsA and CcsB proteins

    • Verify complex formation through co-immunoprecipitation or size exclusion chromatography

    • Confirm structural integrity through negative-stain electron microscopy

  • In Vitro Cytochrome c Maturation Assay

    • Prepare liposomes containing CcsA-CcsB complex

    • Add apocytochrome c substrate, heme, and other necessary components

    • Monitor formation of holocytochrome c through:

      • Heme-associated peroxidase activity

      • Spectroscopic detection of covalently bound heme

      • Mass spectrometry to confirm thioether bond formation

  • Complementation Assays

    • Express A. stolonifera CcsA in ccsA-deficient bacterial or yeast systems

    • Assess restoration of cytochrome c maturation

    • Measure downstream phenotypes (respiration, photosynthetic activity)

Each validation step should include appropriate controls, such as inactive CcsA mutants (with altered conserved residues) and heterologous CcsA proteins from well-characterized systems to benchmark functionality.

What are the best practices for designing experiments to study CcsA interactions with other cytochrome c biogenesis components?

To effectively study CcsA interactions with other components of the cytochrome c biogenesis System II, researchers should follow these experimental design best practices:

Interaction Partner Identification:

  • Start with known System II components: CcsB (ResB), CcdA, and CcsX (ResA)

  • Design constructs with compatible affinity tags for co-purification experiments

  • Consider using the CcsBA fusion proteins from ε-proteobacteria as experimental models

Interaction Mapping Protocol:

  • Initial Screening

    • Yeast two-hybrid or bacterial two-hybrid systems using membrane protein-specific variants

    • Split-ubiquitin assays optimized for membrane protein interactions

    • Systematic co-immunoprecipitation experiments with antibodies against native proteins

  • Interaction Domain Mapping

    • Create truncation libraries of CcsA to identify minimal interaction domains

    • Perform alanine-scanning mutagenesis of conserved residues

    • Use peptide arrays to pinpoint specific interaction motifs

  • Functional Validation

    • Design competition assays using synthetic peptides derived from interaction interfaces

    • Perform site-directed mutagenesis of key residues followed by functional assays

    • Use inducible protein degradation systems to test interaction dependencies in vivo

  • Dynamic Interaction Analysis

    • Implement fluorescence-based approaches (FRET, FLIM, BiFC) in chloroplasts

    • Use hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • Apply cross-linking mass spectrometry to capture transient interactions

When designing these experiments, it's crucial to consider the membrane-embedded nature of CcsA and its potential dependence on the lipid environment for proper folding and function. Using native or biomimetic membrane systems rather than detergent micelles can provide more physiologically relevant results.

What computational tools and resources are most effective for analyzing ccsA sequences and predicting protein structure?

For comprehensive computational analysis of ccsA sequences and CcsA protein structure prediction, researchers should employ a multi-layered approach utilizing specialized tools for membrane proteins:

Sequence Analysis Pipeline:

  • Primary Sequence Analysis

    • Multiple Sequence Alignment: MAFFT or T-Coffee with specific parameters for transmembrane proteins

    • Conservation Analysis: ConSurf or Rate4Site to identify functionally important residues

    • Motif Detection: MEME or ScanProsite to identify conserved cytochrome c biogenesis motifs

  • Transmembrane Topology Prediction

    • TMHMM, TOPCONS, or CCTOP for predicting transmembrane helices

    • SignalP or TargetP for chloroplast targeting sequence prediction

    • PRED-TAT for Tat signal sequence identification (relevant for System II substrates)

  • Structural Prediction

    • AlphaFold2 or RoseTTAFold with specific protocols for membrane proteins

    • MODELLER for homology modeling using ε-proteobacterial CcsBA fusion proteins as templates

    • Molecular dynamics simulations in explicit membrane environments using GROMACS or NAMD

  • Functional Site Prediction

    • 3DLigandSite or COACH for heme-binding site prediction

    • InterProScan for functional domain identification

    • FTMap for identification of potential protein-protein interaction hotspots

  • Evolutionary Analysis

    • PAML or HyPhy for detecting sites under selection pressure

    • Coevolution analysis using GREMLIN or EVcouplings to predict residue contacts

    • Ancestral sequence reconstruction to infer evolutionary trajectories

For chloroplast-specific analyses, researchers should utilize the comprehensive chloroplast genome databases derived from sequencing projects of related species like Deschampsia antarctica , which can provide valuable comparative data for understanding ccsA gene context and evolution in Agrostis stolonifera.

How might advances in synthetic biology enable novel applications of recombinant CcsA?

Advances in synthetic biology present exciting opportunities for utilizing recombinant CcsA from A. stolonifera in various applications. These approaches could transform our understanding of cytochrome c biogenesis and enable novel biotechnological applications:

Synthetic Biology Applications:

  • Engineered Cytochrome Assembly Systems

    • Design of minimal cytochrome c biogenesis systems with optimized efficiency

    • Creation of orthogonal heme attachment pathways for installing modified hemes

    • Development of inducible cytochrome maturation systems for controlled electron transport

  • Biosensor Development

    • Engineering CcsA-based sensors for detecting heme availability in plants

    • Creating redox-responsive systems that adjust cytochrome assembly to environmental conditions

    • Developing diagnostic tools for assessing chloroplast functionality

  • Improved Photosynthetic Efficiency

    • Optimizing cytochrome c biogenesis for enhanced electron transport capacity

    • Engineering stress-resistant variants of CcsA for maintaining photosynthesis under adverse conditions

    • Creating synthetic electron transport chains with novel properties

  • Protein Engineering Platforms

    • Using CcsA as a platform for directed evolution of novel heme attachment activities

    • Developing CcsA variants capable of installing non-natural cofactors

    • Creating chimeric proteins combining features from different biogenesis systems

What is known about post-translational regulation of CcsA and how can it be studied?

Known and Predicted Regulatory Mechanisms:

  • Phosphorylation

    • Potential phosphorylation sites in stromal domains may regulate interaction with other components

    • Methodology: Phosphoproteomics combined with site-directed mutagenesis of predicted sites

  • Redox Regulation

    • Conserved cysteine residues may form regulatory disulfide bonds

    • Methodology: Non-reducing gel electrophoresis and redox titration experiments

  • Protein-Protein Interactions

    • Interaction with regulatory proteins beyond core System II components

    • Methodology: Proximity labeling approaches (BioID, APEX) in chloroplasts

  • Proteolytic Processing

    • Potential maturation through N-terminal processing after import

    • Methodology: N-terminal sequencing and transit peptide analysis

  • Membrane Microdomain Localization

    • Association with specific lipid environments affecting function

    • Methodology: Membrane fractionation and fluorescence microscopy with domain-specific markers

Experimental Strategy for Studying PTMs:
A comprehensive study should combine bottom-up proteomics (to identify modification sites), targeted mutagenesis (to assess functional significance), and advanced microscopy (to track spatial regulation). Special attention should be paid to environmental conditions that might trigger regulatory changes, particularly in stress-adaptive species like A. stolonifera.

How does the genetic diversity of A. stolonifera populations affect ccsA sequence and function?

Agrostis stolonifera is known for its extensive ecological range, inhabiting diverse environments from wetlands to drier areas . This ecological diversity may be reflected in genetic variation of the ccsA gene across different populations:

Population Genetics Approach:

  • Sampling Strategy

    • Collect A. stolonifera samples from diverse habitats (wetlands, salt marshes, vernal pools, high-altitude locations)

    • Include populations from native and invaded ranges to assess adaptive variation

  • Sequence Analysis

    • Perform targeted sequencing of the ccsA gene and flanking regions

    • Identify single nucleotide polymorphisms (SNPs) and insertion/deletion variants

    • Calculate population genetic parameters (π, Tajima's D, FST) to detect selection signatures

  • Functional Validation

    • Express variant CcsA proteins in heterologous systems

    • Assess functional differences in cytochrome c maturation efficiency

    • Correlate functional differences with environmental parameters

Expected Patterns: We might observe higher conservation in catalytic domains and more variation in regulatory regions. Populations from extreme environments (high salinity, drought, temperature extremes) may show adaptive variants that maintain cytochrome biogenesis efficiency under stress conditions. These variations could be particularly informative for understanding the evolutionary adaptations of the cytochrome c biogenesis system and potentially for engineering stress-resistant variants for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.