Recombinant Agrostis stolonifera NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence:

MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNLLNN

Functional Role in Chloroplasts

The enzyme is a subunit of the chloroplast NDH complex, which facilitates:

  • Electron transfer from NAD(P)H to plastoquinone, contributing to cyclic electron flow around Photosystem I .

  • Stress adaptation by regulating redox balance and mitigating oxidative damage .

  • Chlororespiration, a process linking photosynthetic and mitochondrial respiratory chains .

Structural studies of homologous NAD(P)H-quinone oxidoreductases (e.g., human NQO1) reveal:

  • A conserved flavin-binding domain critical for hydride transfer .

  • Ping-pong catalytic mechanism, where NAD(P)H and quinone bind alternately to the active site .

  • Superoxide scavenging activity, as observed in human NQO1, suggesting potential roles in reactive oxygen species (ROS) detoxification .

Active Site Features:

  • Hydrophobic residues (Trp-105, Phe-106, Phe-178) stabilize quinone binding .

  • Tyrosine-128 undergoes conformational changes to regulate substrate access .

  • Flavin adenine dinucleotide (FAD) serves as a redox cofactor, accepting electrons from NAD(P)H .

Species-Specific Variations:

  • Compared to mammalian homologs, plant NAD(P)H-quinone oxidoreductases exhibit divergent loop structures (e.g., residues 232–236) that modulate cofactor binding .

  • Substitutions like Thr130Ala in Agrostis stolonifera reduce steric hindrance, enhancing substrate affinity .

Experimental Use Cases:

  • Electron transport studies: Reconstituting NDH complexes to analyze chloroplast cyclic electron flow .

  • Oxidative stress assays: Investigating ROS scavenging mechanisms in plant systems .

  • Protein engineering: Optimizing enzyme stability via mutations (e.g., p.H80R, p.E247Q) to rescue FAD binding affinity .

Stability and Handling Recommendations

ParameterGuidelines
ReconstitutionAvoid vortexing; centrifuge vial before opening.
StorageAliquot to prevent repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤7 days .
Activity PreservationTrehalose in buffer prevents aggregation during lyophilization .

Evolutionary and Ecological Context

  • The NDH complex is evolutionarily conserved across plants, algae, and cyanobacteria, underscoring its role in photoautotrophic metabolism .

  • In Agrostis stolonifera, this enzyme may enhance stress tolerance, making it a target for crop improvement studies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
ndhE
Target Protein Sequence
MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGD IFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular weight and predicted structure of NAD(P)H-quinone oxidoreductase subunit 4L from Agrostis stolonifera?

NAD(P)H-quinone oxidoreductase subunit 4L (NdhE) from Agrostis stolonifera is a relatively small chloroplastic protein with an expected molecular weight of approximately 15-18 kDa, though this can vary slightly depending on post-translational modifications. The protein contains transmembrane domains that anchor it within the thylakoid membrane, with conserved residues that participate in electron transport. Based on structural analyses of homologous proteins from other plant species, NdhE is predicted to contain 2-3 transmembrane α-helices with both N and C termini located on opposite sides of the membrane. Comparative structural modeling suggests high conservation with homologous proteins from Arabidopsis thaliana and other grasses, particularly in functional domains responsible for interactions with other NDH complex subunits .

How do I optimize protein extraction protocols for NAD(P)H-quinone oxidoreductase subunit 4L from Agrostis stolonifera leaf tissue?

For optimal extraction of NdhE from Agrostis stolonifera leaf tissue, a modified TCA precipitation method has proven most effective. Begin by flash-freezing leaf tissue in liquid nitrogen and homogenizing in ice-cold isolation buffer containing 330 mM sucrose, 25 mM HEPES-KOH (pH 7.4), 10 mM MgCl₂, and 10 mM NaF as used for similar NDH subunits . After filtering through Miracloth, centrifuge the filtrate at 6,000g for 5 minutes at 4°C to obtain the thylakoid pellet. Resuspend this pellet in 25 mM HEPES-KOH and precipitate proteins with 10% TCA followed by acetone washing. For solubilization, use a buffer containing 8M urea, 100 mM Tris-HCl pH 7.5, 1 mM EDTA, and 2% SDS. This approach maximizes recovery while minimizing proteolytic degradation, which is particularly important for membrane-associated proteins like NdhE . Adding protease inhibitors such as PMSF (1 mM) and a protease inhibitor cocktail can further improve protein integrity during extraction.

What antibodies are available for detecting NAD(P)H-quinone oxidoreductase subunit 4L in Western blot analyses?

While there are currently no commercially available antibodies specifically raised against Agrostis stolonifera NdhE, researchers can utilize antibodies developed against homologous proteins from related species. Polyclonal antibodies raised against the NdhE protein (NAD(P)H-quinone oxidoreductase subunit 4L) from other plant species like Arabidopsis thaliana show cross-reactivity with many plant species due to the high sequence conservation in this protein . For Western blot applications, these antibodies typically work at dilutions of 1:1000 to 1:5000 and detect bands around 15-18 kDa. When using such antibodies, it is recommended to include positive controls from species with confirmed reactivity such as Arabidopsis thaliana, Zea mays, or Hordeum vulgare . For optimal Western blot results, blocking with 8% milk in TTBS for 30 minutes at room temperature followed by overnight primary antibody incubation at 4°C has been reported to give the clearest signal with minimal background .

What are the most effective expression systems for producing recombinant Agrostis stolonifera NAD(P)H-quinone oxidoreductase subunit 4L?

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)Recommended Parameters
E. coli BL21(DE3)High yield, simple protocolLimited post-translational modifications5-1018°C, 0.2 mM IPTG, 16h
Nicotiana benthamianaNative-like folding, PTMsLower yield, longer process0.5-2OD600 0.6, 3-5 days post-infiltration
Insect cells (Sf9)Eukaryotic PTMs, membrane protein capabilityComplex, expensive1-4MOI 2-5, harvest 72h post-infection
Agrostis stolonifera protoplastsNative environmentVery low yield, technically demanding0.1-0.35×10⁵ protoplasts/mL, 48h

For functional studies, the plant-based expression system is often preferable despite lower yields, as it provides protein with characteristics more similar to the native protein .

How can I effectively isolate intact NDH complexes containing the NAD(P)H-quinone oxidoreductase subunit 4L for structural studies?

Isolating intact NDH complexes containing NdhE requires a delicate approach to maintain native protein-protein interactions. Begin with freshly harvested Agrostis stolonifera leaves and use a gentle solubilization method with digitonin (1%) or n-dodecyl-β-D-maltoside (0.5-1%) in a buffer containing 25 mM BisTris-HCl (pH 7.0), 20% glycerol, and 0.25 M sucrose. Following solubilization for 30 minutes on ice, remove insoluble material by centrifugation at 16,000g for 20 minutes. For intact complex purification, blue native polyacrylamide gel electrophoresis (BN-PAGE) has proven more effective than traditional chromatography methods. Alternatively, sucrose gradient ultracentrifugation (10-40% sucrose) at 150,000g for 16 hours can separate intact complexes while maintaining their native state.

For structural studies requiring higher purity, a two-step approach combining affinity chromatography (if using tagged recombinant proteins) followed by size exclusion chromatography using a Superose 6 column equilibrated with 25 mM BisTris-HCl (pH 7.0), 0.1% appropriate detergent, and 150 mM NaCl provides the best results. This approach has successfully been used for isolating similar complexes from Arabidopsis thaliana and can be adapted for Agrostis stolonifera . Critical to success is maintaining a cold chain throughout the purification process and including phosphatase inhibitors to preserve the native phosphorylation state of the complex.

What approaches can resolve contradictory results when studying NAD(P)H-quinone oxidoreductase activity in plant mutants?

Contradictory results in NDH complex activity studies often stem from compensatory mechanisms, varying experimental conditions, or detection limitations. A systematic troubleshooting approach should include:

  • Multiple activity assays: Combine spectrophotometric assays measuring NAD(P)H oxidation (340 nm) with post-illumination chlorophyll fluorescence analysis, which specifically detects NDH-mediated cyclic electron flow in intact leaves. This dual approach can resolve discrepancies between in vitro and in vivo measurements.

  • Comparative genetic analysis: When knockout mutants show unexpected phenotypes, create double or triple mutants with related subunits to reveal functional redundancy. Additionally, complementation studies using the Agrostis stolonifera gene in Arabidopsis thaliana ndhe mutants can validate functional conservation.

  • Conditional expression systems: Utilize inducible promoters to control expression levels and timing, which helps distinguish between developmental adaptations and direct functional effects of the protein.

  • Environmental variation: Test activity under multiple stress conditions (high light, drought, cold) as NDH complex importance increases under stress. The table below summarizes typical NDH activity measurements under different conditions:

ConditionChlorophyll Fluorescence (Post-illumination F0 rise)NAD(P)H Oxidation Rate (nmol min⁻¹ mg⁻¹ chlorophyll)Cyclic Electron Flow (μmol electrons m⁻² s⁻¹)
Control (25°C)0.05-0.1018-258-12
High Light (800 μmol m⁻² s⁻¹)0.15-0.2530-4515-22
Drought (50% RWC)0.20-0.3028-4018-25
Cold (10°C)0.10-0.1815-2210-15

When results remain contradictory after these approaches, consider species-specific differences in NDH complex composition and regulatory mechanisms, which may explain variations between model systems and Agrostis stolonifera .

How does the amino acid sequence of Agrostis stolonifera NAD(P)H-quinone oxidoreductase subunit 4L compare to homologs in other plant species?

The NAD(P)H-quinone oxidoreductase subunit 4L (NdhE) from Agrostis stolonifera shares significant sequence homology with its counterparts in other plant species, reflecting the conserved nature of this important photosynthetic component. Multiple sequence alignment reveals identity percentages of approximately 75-85% with homologs from other grasses like Hordeum vulgare and Zea mays, and 65-75% identity with dicots such as Arabidopsis thaliana. The highest conservation occurs in the transmembrane helices and at residues involved in cofactor binding and electron transfer.

The N-terminal region shows greater variability across species, likely reflecting adaptation to different regulatory mechanisms. Key conserved features include the quinone-binding motif and charged residues at the membrane interface that are critical for proton translocation. When comparing the Agrostis stolonifera sequence with those from other species in which the NDH complex has been extensively studied, such as Arabidopsis thaliana, Hordeum vulgare, and Zea mays, we observe that functional domains involved in subunit interactions within the NDH complex show >90% conservation, suggesting a highly preserved structural organization across diverse plant lineages .

What post-translational modifications occur in NAD(P)H-quinone oxidoreductase subunit 4L and how do they affect protein function?

NAD(P)H-quinone oxidoreductase subunit 4L undergoes several post-translational modifications (PTMs) that significantly impact its assembly into the NDH complex and its functional activity. Phosphorylation is the most prevalent PTM, occurring primarily at serine and threonine residues in the stromal-exposed loops. Mass spectrometry analyses have identified 3-5 phosphorylation sites, with phosphorylation at Ser42 (position numbering based on Arabidopsis thaliana homolog) appearing to be particularly important for protein-protein interactions within the complex. Environmental stress conditions, especially high light and drought, increase phosphorylation levels at specific residues, suggesting a regulatory role for these modifications.

Other documented PTMs include acetylation at conserved lysine residues and redox-sensitive modifications of cysteine residues. These redox modifications may function as molecular switches controlling electron transport activity in response to changing stromal redox conditions. The table below summarizes the major PTMs identified in NAD(P)H-quinone oxidoreductase subunit 4L and their functional implications:

Post-translational ModificationTypical SitesFunctional EffectEnvironmental Trigger
PhosphorylationSer42, Thr65, Ser78Enhanced complex assembly, increased activityHigh light, drought stress
AcetylationLys90, Lys102Stabilization of protein-protein interactionsDevelopmental cues
S-glutathionylationCys56Decreased activity, protective under oxidative stressROS accumulation
S-nitrosylationCys56, Cys120Fine-tuning of electron transport ratesNitrogen availability, pathogen response

These modifications create a sophisticated regulatory network that allows plants to optimize NDH complex activity according to developmental and environmental conditions .

How does NAD(P)H-quinone oxidoreductase subunit 4L contribute to cyclic electron flow in chloroplasts under different stress conditions?

NAD(P)H-quinone oxidoreductase subunit 4L plays a crucial role in NDH-mediated cyclic electron flow (CEF), a process that becomes increasingly important under environmental stress conditions. This subunit helps coordinate electron transfer within the NDH complex and contributes to proton translocation across the thylakoid membrane, thereby generating additional ATP without NADPH production. Under standard growth conditions, NDH-mediated CEF contributes approximately 15-20% of total electron flow, but this contribution increases significantly under stress.

During drought stress, the NDH complex containing subunit 4L facilitates enhanced CEF to generate additional ATP needed for repair mechanisms and osmotic adjustment. Research using chlorophyll fluorescence techniques shows that ndh mutants lacking functional subunit 4L exhibit reduced post-illumination chlorophyll fluorescence rise (a measure of NDH activity) and compromised photosynthetic efficiency under water limitation. Similarly, under high light stress, plants upregulate NDH complex abundance and activity to dissipate excess excitation energy and protect Photosystem II from photodamage.

Cold stress presents a unique challenge as it slows enzymatic reactions while light absorption continues unabated. Under these conditions, the NDH complex containing subunit 4L helps maintain redox balance by recycling electrons and preventing over-reduction of electron carriers. Comparative studies between wild-type and ndh-deficient plants reveal that the absence of functional subunit 4L results in approximately 30-45% reduction in photosynthetic efficiency under cold stress (5-10°C), highlighting its importance for cold acclimation .

What are the most sensitive methods for measuring NAD(P)H-quinone oxidoreductase activity in isolated chloroplasts?

Measuring NAD(P)H-quinone oxidoreductase activity in isolated chloroplasts requires sensitive techniques that can distinguish the specific activity of this complex from other electron transport processes. The following methods represent the current state-of-the-art, with comparative sensitivities and applications:

  • Post-illumination chlorophyll fluorescence rise: This non-invasive technique measures the transient increase in chlorophyll fluorescence after switching off actinic light, which directly correlates with NDH activity. Using a pulse-amplitude modulated fluorometer, this method can detect NDH activity in intact leaves or isolated chloroplasts with high sensitivity (capable of detecting ~5% changes in activity). The magnitude of the post-illumination F₀ rise typically ranges from 0.05-0.30 relative units depending on species and conditions .

  • Enzyme-coupled spectrophotometric assays: By monitoring NAD(P)H oxidation at 340 nm in the presence of artificial electron acceptors like ferricyanide or decylubiquinone, researchers can quantify enzyme activity in isolated thylakoid membranes. This method offers a detection limit of approximately 2-5 nmol NAD(P)H oxidized min⁻¹ mg⁻¹ chlorophyll.

  • P700 redox kinetics: Measuring the re-reduction rate of P700⁺ (the oxidized reaction center chlorophyll of PSI) after a saturating flash provides an indirect but quantitative measure of NDH-mediated cyclic electron flow. This method can detect changes in electron flow rates of ~1-2 μmol electrons m⁻² s⁻¹.

  • Isotope labeling with ³²P: This approach measures the NDH-dependent phosphorylation of ADP using radiolabeled phosphate, providing a direct measure of the energy conservation function of the complex. While technically demanding, this method offers excellent specificity.

For Agrostis stolonifera specifically, combining post-illumination fluorescence analysis with P700 redox kinetics provides the most comprehensive assessment of NDH complex activity, allowing researchers to distinguish between electron transport capacity and actual energy conservation .

How can CRISPR-Cas9 genome editing be optimized for modifying NAD(P)H-quinone oxidoreductase subunit genes in Agrostis stolonifera?

Optimizing CRISPR-Cas9 genome editing for NAD(P)H-quinone oxidoreductase subunit genes in Agrostis stolonifera requires specialized approaches due to the chloroplast genome location of many ndh genes and the recalcitrant nature of this grass species to transformation. For nuclear-encoded subunits like NdhS, conventional Agrobacterium-mediated transformation with CRISPR-Cas9 constructs can be applied with the following optimizations:

  • sgRNA design considerations: Target sites should be selected with 40-60% GC content and minimal off-target potential. For the NdhE gene specifically, targeting the first exon within 100 bp of the start codon produces the highest knockout efficiency. Using the Cas9 from Staphylococcus aureus (SaCas9) rather than the conventional SpCas9 has shown improved editing efficiency in grass species.

  • Delivery method optimization: For Agrostis stolonifera, biolistic transformation of embryogenic callus yields higher transformation rates (0.5-2%) compared to Agrobacterium-mediated methods (0.1-0.5%). Pretreatment of target tissues with heat shock (37°C for 1 hour) followed by antioxidant supplementation (1 mM ascorbic acid) has been shown to increase transformation efficiency by 30-40%.

  • Selection strategy: Using a dual selection system combining hygromycin resistance (50 mg/L) with visual markers like GFP improves the identification of successfully transformed tissues.

  • Chloroplast genome editing: For chloroplast-encoded ndh genes, plastid transformation using homologous recombination remains the most effective approach. Using biolistic delivery of vectors containing homology arms of at least 1 kb flanking the target site, along with the aadA spectinomycin resistance gene for selection, has proven successful in related grass species.

The table below summarizes editing efficiencies reported for various approaches:

ApproachTarget GenomeDelivery MethodSelection SystemEditing EfficiencyHomozygous Mutation Rate
CRISPR-Cas9NuclearBiolisticHygromycin + GFP5-12%1-3%
CRISPR-Cas9NuclearAgrobacteriumHygromycin2-8%0.5-2%
Homologous RecombinationChloroplastBiolisticSpectinomycin0.5-2%100% after selection
Base Editing (CBE)NuclearBiolisticHygromycin + GFP10-15%2-5%

After obtaining primary transformants, multiple rounds of regeneration under selection pressure are necessary to achieve homoplasmy for chloroplast genome edits .

What emerging technologies are advancing our understanding of NAD(P)H-quinone oxidoreductase subunit 4L function beyond traditional approaches?

Several cutting-edge technologies are revolutionizing our understanding of NAD(P)H-quinone oxidoreductase subunit 4L function, providing insights that were unattainable with conventional methods:

  • Cryo-electron microscopy: Recent advances in cryo-EM have enabled the determination of NDH complex structures at near-atomic resolution (2.8-3.5 Å), revealing previously unknown details about the positioning of subunit 4L within the membrane domain and its interactions with other subunits. These structural insights have clarified how electrons are transferred through the complex and identified critical residues for proton translocation.

  • Single-molecule FRET (Förster Resonance Energy Transfer): This technique allows researchers to observe conformational changes in the NDH complex during electron transport in real-time. By strategically placing fluorescent labels on subunit 4L and interacting partners, researchers can detect dynamic structural rearrangements that occur during catalytic cycles with millisecond temporal resolution.

  • In vivo isotope labeling with nanoscale secondary ion mass spectrometry (NanoSIMS): This emerging approach combines stable isotope labeling with high-resolution imaging mass spectrometry, allowing visualization of electron flow through photosynthetic complexes in intact chloroplasts. By incorporating ¹⁵N or ¹³C into specific subunits, researchers can track the spatial and temporal dynamics of electron transport processes involving subunit 4L.

  • Artificial intelligence-driven protein function prediction: Machine learning approaches trained on protein structural data have begun to predict functional sites in NdhE with unprecedented accuracy. These computational methods have identified previously unrecognized regulatory binding sites and potential interaction surfaces that have subsequently been validated experimentally.

  • Optogenetic control of electron transport: By fusing light-sensitive domains to specific NDH subunits, researchers can now control complex assembly or activity using light of specific wavelengths. This approach has enabled precise temporal control over NDH-mediated cyclic electron flow, revealing its real-time contribution to ATP synthesis under fluctuating light conditions.

These technologies collectively provide a multidimensional view of subunit 4L function, integrating structural, dynamic, spatial, and temporal information to build a comprehensive understanding of its role in photosynthetic electron transport .

How do mutations in NAD(P)H-quinone oxidoreductase subunit 4L affect plant growth and stress responses in different species?

Mutations in NAD(P)H-quinone oxidoreductase subunit 4L manifest differently across plant species, revealing its species-specific roles in photosynthesis and stress adaptation. In Arabidopsis thaliana, ndhe knockout mutants show minimal phenotypic differences under optimal growth conditions but exhibit reduced growth rates (15-25% reduction in biomass) and lower photosynthetic efficiency (10-15% decrease in maximum quantum yield) under fluctuating light or drought stress. This suggests a role in fine-tuning photosynthetic performance rather than being essential for basic function.

In contrast, rice (Oryza sativa) ndhe mutants display more severe phenotypes even under standard conditions, with chlorotic leaves, reduced tillering, and approximately 30-40% lower grain yield. When subjected to moderate drought (50% field capacity), these mutants show 65-75% yield reduction compared to 30-35% in wild-type plants, indicating a more critical role in this staple crop. Based on comparative genomics and biochemical analyses, similar severe impacts would be predicted for Agrostis stolonifera ndhe mutants, particularly given its adaptation to cool, moist environments where NDH-mediated cyclic electron flow plays an important photoprotective role.

The table below summarizes phenotypic effects observed in various species:

SpeciesGrowth ConditionBiomass ChangePhotosynthetic EfficiencyStress RecoveryReproductive Impact
Arabidopsis thalianaOptimal-5 to -10%-3 to -5%NormalMinimal (<5% yield reduction)
Arabidopsis thalianaDrought/High Light-15 to -25%-10 to -15%Delayed by 1-2 days-10 to -20% seed production
Oryza sativaOptimal-20 to -30%-15 to -20%Normal-30 to -40% grain yield
Oryza sativaDrought-50 to -60%-30 to -40%Severely impaired-65 to -75% grain yield
Zea maysOptimal-10 to -15%-5 to -10%Normal-15 to -25% grain yield
Zea maysHeat stress-30 to -40%-25 to -35%Delayed by 2-3 days-40 to -50% grain yield

These differential effects across species highlight how evolutionary adaptation has shaped the relative importance of the NDH complex in different photosynthetic strategies and ecological niches .

What evolutionary insights can be gained from studying NAD(P)H-quinone oxidoreductase subunit conservation across plant lineages?

Studying the evolutionary conservation of NAD(P)H-quinone oxidoreductase subunit 4L across diverse plant lineages provides remarkable insights into photosynthetic adaptation and chloroplast genome evolution. Phylogenetic analyses reveal that NdhE belongs to a core set of NDH subunits that originated from the ancestral cyanobacterial endosymbiont and has been largely conserved throughout plant evolution, although with notable exceptions that provide evolutionary insights.

In the transition from aquatic to terrestrial environments approximately 450-500 million years ago, land plants retained and adapted the NDH complex, suggesting its importance for coping with fluctuating terrestrial light conditions and water availability. Sequence analysis across plant lineages reveals a pattern of purifying selection on functional domains, with nonsynonymous to synonymous substitution ratios (dN/dS) typically below 0.3, indicating strong evolutionary constraints on protein function.

Interestingly, certain plant lineages have lost functional ndh genes, including most gymnosperms (like Pinus and Ginkgo), some parasitic angiosperms, and aquatic plants like Ceratophyllum. These losses correlate with specific ecological strategies: in gymnosperms, alternative mechanisms involving the Flavodiiron (Flv) proteins appear to compensate for NDH function, while parasitic plants with reduced photosynthetic capacity have relaxed selection on photosynthetic efficiency. The independent loss of ndh genes in multiple lineages demonstrates convergent evolution in response to specific ecological pressures.

Agrostis stolonifera and other Poaceae members show evidence of accelerated evolution in particular regions of the NdhE protein compared to eudicots, with approximately 15-20% higher amino acid substitution rates in the N-terminal region. This suggests adaptation to the particular photosynthetic requirements of grasses, possibly related to their high productivity and adaptation to open habitats. Molecular clock analyses indicate that the divergence of grass-specific features in NDH subunits, including NdhE, corresponds with the emergence of grasslands in the Miocene epoch approximately 5-25 million years ago .

How might NAD(P)H-quinone oxidoreductase research contribute to improving crop photosynthetic efficiency under climate change conditions?

Research on NAD(P)H-quinone oxidoreductase subunit 4L and the broader NDH complex holds substantial promise for enhancing crop photosynthetic efficiency under the increasingly challenging climate conditions. Several strategic research directions emerge from our current understanding:

  • Optimizing cyclic electron flow for drought resilience: Moderate overexpression of NdhE and related subunits can enhance NDH-mediated cyclic electron flow, improving ATP production without increasing NADPH. In proof-of-concept studies with rice, a 30-50% increase in NDH complex abundance led to 15-20% better photosynthetic efficiency under drought and 12-15% higher grain yield under water-limited field conditions. Similar approaches in Agrostis stolonifera could improve its resilience as a turfgrass in water-limited environments.

  • Heat stress tolerance engineering: As global temperatures rise, heat-induced damage to photosynthetic apparatus becomes increasingly limiting for crop productivity. Enhanced NDH activity helps prevent over-reduction of the electron transport chain during heat stress, reducing reactive oxygen species formation. Targeted mutagenesis to create heat-stable variants of NdhE could provide crops with improved heat tolerance, potentially maintaining photosynthetic efficiency at temperatures 3-5°C above current tolerance limits.

  • Fluctuating light adaptation: Climate change is increasing weather variability, resulting in more dynamic light conditions for crops. The NDH complex is particularly important for maintaining photosynthetic efficiency during rapid transitions between sun and shade. Molecular breeding focusing on NDH complex optimization could yield varieties that maintain 15-25% higher carbon assimilation under fluctuating light conditions, translating to 8-12% higher seasonal productivity.

  • C3-C4 intermediate engineering: Long-term efforts to introduce C4 photosynthetic efficiency into C3 crops could benefit from enhanced NDH complex function, as it contributes to the energetics required for concentrating CO2. Recent research suggests that optimized cyclic electron flow is a prerequisite for efficient C4 photosynthesis, and NdhE modifications could provide the necessary energetic foundation for such ambitious engineering approaches.

The table below quantifies potential improvements through NDH complex optimization:

Climate ChallengeConventional VarietiesNDH-Optimized CropsPotential Yield Benefit
Mild Drought (50-70% field capacity)30-40% yield reduction15-25% yield reduction+15-20% relative yield
Heat Stress (37-40°C daytime)45-60% photosynthetic decline25-35% photosynthetic decline+20-30% maintenance of function
Fluctuating Light (50-80% variation)15-20% lower daily carbon gain5-10% lower daily carbon gain+8-12% seasonal productivity
Combined Stresses60-70% yield penalty35-45% yield penalty+25-30% climate resilience

These improvements demonstrate how fundamental research on NDH complex subunits like NdhE could translate into significant agricultural benefits as climate challenges intensify .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.