Recombinant Agrostis stolonifera Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
ycf4
Target Protein Sequence
MNWRSEHVWVELLKGSRKRGNFFWACILFLGSLGFLSVGASSYLGKNIISILPSQQILFF PQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLQF LMRDIQSIRIQVKEGLYPRRILYMEIRGQGVIPLTRTDEKFFTPREIEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 protein and what role does it play in photosystem I assembly?

Ycf4 (hypothetical chloroplast reading frame no. 4) is a thylakoid protein encoded by the chloroplast genome that functions as an essential assembly factor for photosystem I (PSI) complex formation. The protein serves as a scaffold for PSI assembly, facilitating the coordinated integration of both nucleus-encoded and chloroplast-encoded protein subunits along with cofactors such as chlorophylls, carotenoids, and iron-sulfur clusters .

In the green alga Chlamydomonas reinhardtii, Ycf4 is absolutely essential for PSI accumulation, while in higher plants such as tobacco (Nicotiana tabacum), knockout plants can still accumulate some PSI, although they are severely affected in photosynthetic performance . This indicates that the dependency on Ycf4 for PSI assembly varies across evolutionary lineages.

What experimental approaches are most effective for studying Ycf4 function?

Several complementary experimental approaches have proven effective for investigating Ycf4 function:

  • Chloroplast genome transformation: Stable transformation of the chloroplast genome to generate ycf4 knockout plants has been instrumental in determining its essentiality in different species. This technique revealed that in tobacco, unlike in Chlamydomonas, Ycf4 is not absolutely essential for photosynthesis .

  • Tandem affinity purification (TAP) tagging: This approach was successfully used to purify Ycf4-containing complexes from Chlamydomonas, revealing its association with other proteins involved in PSI assembly. Researchers fused a TAP tag to Ycf4 and expressed it in cells, enabling efficient isolation of the large Ycf4-containing complex (>1500 kD) .

  • Site-directed mutagenesis: Targeted mutation of conserved residues (e.g., R120, E179, E181) has helped identify amino acids critical for Ycf4 stability and function. For instance, R120A and R120Q mutations were shown to destabilize the Ycf4 protein .

  • Pulse-chase protein labeling: This technique revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, supporting the role of Ycf4 as a scaffold for PSI assembly .

  • Electron microscopy and single particle analysis: These imaging techniques have been applied to visualize the purified Ycf4 complex, revealing particles measuring approximately 285 × 185 Å .

How can recombinant Ycf4 protein be effectively used for in vitro studies?

Recombinant Ycf4 proteins, such as those from Agrostis stolonifera, can be powerful tools for in vitro studies of PSI assembly. Based on information from similar recombinant proteins, the following methodological approaches are recommended:

  • Expression and purification: The most effective system for expressing functional Ycf4 is E. coli with an N-terminal His tag for purification. The protein is typically obtained as a lyophilized powder after purification and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage considerations: For optimal stability, add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Working aliquots can be stored at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided .

  • Protein-protein interaction studies: Recombinant Ycf4 can be used for in vitro binding assays with other PSI assembly factors and subunits to determine direct interactions and assembly intermediates.

  • Structural studies: Purified recombinant Ycf4 can be used for structural analyses using X-ray crystallography or cryo-electron microscopy to determine its three-dimensional structure.

  • Reconstitution experiments: In vitro reconstitution of partial PSI assembly using recombinant Ycf4 and other purified components can help elucidate the step-by-step assembly process.

What is known about the composition and structure of the Ycf4-containing complex?

The Ycf4-containing complex is a large molecular assembly exceeding 1500 kD in size. Detailed biochemical and structural studies, particularly in Chlamydomonas reinhardtii, have revealed its composition and potential function:

  • Protein composition: Mass spectrometry (liquid chromatography-tandem mass spectrometry) and immunoblotting analyses have identified the following components in the complex:

    • Ycf4 (the scaffold protein)

    • COP2 (an opsin-related protein)

    • PSI subunits: PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF

  • Structural features: Electron microscopy has shown that the largest structures in purified preparations measure approximately 285 × 185 Å. These particles may represent several large oligomeric states .

  • Assembly dynamics: Pulse-chase protein labeling experiments revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, indicating that the complex functions as an intermediate during PSI biogenesis .

  • Stability factors: The stability of the Ycf4 complex is influenced by the presence of COP2. RNA interference experiments reducing COP2 to 10% of wild-type levels increased the salt sensitivity of the Ycf4 complex stability but did not affect PSI accumulation, suggesting that COP2 contributes to complex stability but is not essential for PSI assembly .

How do mutations in conserved residues affect Ycf4 stability and function?

Site-directed mutagenesis studies have revealed several critical residues in Ycf4 that impact its stability and function:

MutationEffect on Ycf4 AccumulationEffect on PSI AccumulationFunctional Implication
R120AReduced to 20% of wild-type level (logarithmic growth); almost none in stationary phaseNormalR120 is required for Ycf4 stability but not function
R120QReduced to 20% of wild-type level (logarithmic growth); almost none in stationary phaseNormalR120 is required for Ycf4 stability but not function
E179QNormalNormalE179 is tolerant to conservative substitution
E179AReduced to 50% of wild-type levelNormalE179 contributes to stability but not function
E181QNormalNormalE181 is tolerant to conservative substitution
E181AReduced to 30% of wild-type levelDecreased by 60%E181 is important for both stability and function

These findings indicate that:

  • R120 is critical for protein stability but not directly involved in PSI assembly function

  • E179 contributes to protein stability but is not essential for function

  • E181 is important for both protein stability and PSI assembly function

Interestingly, even when Ycf4 accumulation was reduced to 20% of wild-type levels in the R120 mutants, PSI accumulated at normal levels, suggesting that wild-type cells accumulate approximately 5-fold more Ycf4 than is required for normal PSI complex synthesis under laboratory conditions .

How has the ycf4 gene evolved across different plant lineages?

The evolution of the ycf4 gene shows remarkable variation across plant lineages, with evidence of both conservation and accelerated evolution:

  • General conservation: In most angiosperms, Ycf4 is almost universally 184 or 185 amino acids long and shows relatively slow evolution at both nonsynonymous (dN) and synonymous (dS) sites compared to nuclear genes .

  • Legume expansion: In soybean and Lotus japonicus, the Ycf4 protein has expanded to about 200 residues, showing significant size expansion above the typical length .

  • Accelerated evolution in legumes: The ycf4 gene shows much faster nonsynonymous (dN) evolution in most legumes than in other angiosperms, particularly in the genera Desmodium and Lathyrus. This acceleration is locus-specific and lineage-specific, and is not seen in other chloroplast genes like rbcL or matK .

  • Extreme expansion in Lathyrus: The genus Lathyrus shows the greatest increases in Ycf4 size, reaching 340 residues in Lathyrus latifolius and Lathyrus cirrhosus .

  • Pseudogenization: The ycf4 gene has become a pseudogene in three of six Desmodium species and in Clitoria ternatea, suggesting that in some legume lineages, its function may have been lost or transferred to the nuclear genome .

  • Mutation hotspot: In Lathyrus, the genomic region around ycf4 is a dramatic hotspot for point mutations, with a mutation rate estimated to be at least 20-fold higher than the rest of the genome. This region also appears to be a hotspot for the formation and turnover of minisatellite sequences .

What are the major differences in Ycf4 function between green algae and higher plants?

Significant functional differences exist in Ycf4's role between green algae and higher plants:

  • Essentiality: In the green alga Chlamydomonas reinhardtii, Ycf4 is absolutely essential for photosystem I accumulation. In contrast, in higher plants like tobacco (Nicotiana tabacum), ycf4 knockout plants can still accumulate PSI, albeit at reduced levels, and are capable of photoautotrophic growth .

  • Temporal expression: In higher plants, Ycf4 and Y3IP1 (another auxiliary factor involved in PSI assembly) contents decrease strongly with increasing leaf age, whereas PSI contents remain constant. This suggests that PSI is highly stable in higher plants and that its biogenesis is restricted to young leaves .

  • Complex composition: While both algal and plant Ycf4 function in large protein complexes, the specific composition and stoichiometry of these complexes may differ. In Chlamydomonas, the Ycf4 complex contains COP2, which is not reported as a component in higher plant Ycf4 complexes .

  • Redundancy: The ability of higher plants to assemble PSI in the absence of Ycf4, albeit inefficiently, suggests the existence of alternative or redundant assembly pathways that are not present or not sufficient in green algae .

How can recombinant Ycf4 be utilized to study PSI assembly mechanisms?

Recombinant Ycf4 proteins provide valuable tools for investigating PSI assembly mechanisms through several experimental approaches:

  • In vitro reconstitution systems: Purified recombinant Ycf4 can be combined with other PSI subunits and assembly factors to reconstitute the assembly process in a controlled environment. This approach allows for the identification of:

    • The sequential order of subunit addition

    • The timing of cofactor insertion

    • Rate-limiting steps in the assembly process

    • The role of specific domains within Ycf4

  • Protein-protein interaction mapping: Techniques such as pull-down assays, surface plasmon resonance, or isothermal titration calorimetry using recombinant Ycf4 can identify:

    • Direct binding partners of Ycf4

    • Binding affinities between Ycf4 and PSI subunits

    • Structural domains involved in specific interactions

  • Structure determination: High-resolution structural studies of recombinant Ycf4 through X-ray crystallography or cryo-electron microscopy can reveal:

    • The three-dimensional arrangement of functional domains

    • Potential interaction surfaces for PSI subunits

    • Conformational changes that might occur during the assembly process

  • Site-directed mutagenesis: Systematic mutation of conserved residues in recombinant Ycf4 can help map:

    • Amino acids essential for PSI subunit binding

    • Residues involved in complex stability

    • Functional domains specific for different steps in the assembly process

What methods can be used to investigate differences in PSI assembly between species with divergent Ycf4 proteins?

To investigate interspecies differences in PSI assembly mediated by divergent Ycf4 proteins, researchers can employ several methodological approaches:

  • Heterologous complementation experiments: Expressing Ycf4 from one species in a ycf4 knockout background of another species can determine functional conservation or specialization. For example:

    • Expression of Agrostis stolonifera Ycf4 in tobacco ycf4 knockout plants

    • Expression of higher plant Ycf4 in Chlamydomonas ycf4 mutants

    • Creation of chimeric Ycf4 proteins with domains from different species

  • Comparative biochemical analysis: Parallel purification and characterization of Ycf4 complexes from different species can reveal:

    • Differences in complex composition and size

    • Variation in associated PSI subunits

    • Species-specific auxiliary factors

  • Evolutionary rate correlation studies: Analyzing the correlation between Ycf4 evolutionary rates and PSI subunit evolution can identify:

    • Co-evolving residues between Ycf4 and PSI subunits

    • Adaptations specific to different photosynthetic environments

    • Functional constraints on different domains

  • Domain swap experiments: Creating recombinant Ycf4 proteins with swapped domains between species with different PSI assembly requirements can pinpoint:

    • Regions responsible for species-specific functions

    • Domains that confer essentiality in some species but not others

    • Interaction surfaces that have evolved differently

What are common challenges in working with recombinant Ycf4 and how can they be addressed?

Working with recombinant Ycf4 presents several experimental challenges due to its membrane protein nature and involvement in complex assembly processes:

  • Protein solubility issues:

    • Challenge: As a thylakoid protein with transmembrane domains, Ycf4 can be difficult to maintain in solution.

    • Solution: Use appropriate detergents (e.g., n-dodecyl β-D-maltoside or digitonin) or lipid nanodiscs to mimic the native membrane environment. Addition of 6% trehalose to storage buffers can help maintain protein stability .

  • Proper folding during recombinant expression:

    • Challenge: Ensuring correct folding in heterologous expression systems like E. coli.

    • Solution: Consider expression at lower temperatures (16-18°C), use of specialized E. coli strains designed for membrane proteins, or co-expression with chaperones to enhance proper folding.

  • Protein degradation during purification:

    • Challenge: Ycf4 may be prone to degradation during isolation and purification steps.

    • Solution: Include protease inhibitors in all buffers, minimize handling time, maintain samples at 4°C, and consider addition of stabilizing agents like glycerol (5-50%) .

  • Reconstitution after lyophilization:

    • Challenge: Ensuring functionality after reconstitution from lyophilized powder.

    • Solution: Centrifuge vials briefly before opening, use deionized sterile water for reconstitution, and validate protein activity after reconstitution using binding assays with known interaction partners .

  • Assessing functional activity:

    • Challenge: Determining whether recombinant Ycf4 retains its native function in PSI assembly.

    • Solution: Develop in vitro assays that measure binding to PSI subunits or ability to facilitate assembly of partial PSI complexes. Alternatively, test functional complementation in ycf4-deficient organisms.

How can researchers distinguish between direct and indirect effects when studying Ycf4 mutations?

Distinguishing between direct and indirect effects of Ycf4 mutations requires a comprehensive experimental approach:

  • Correlation of Ycf4 levels with PSI accumulation:

    • Method: Quantify Ycf4 and PSI levels in various mutants and under different conditions.

    • Interpretation: The R120A mutation in Chlamydomonas reduced Ycf4 to 20% of wild-type levels without affecting PSI accumulation, indicating that wild-type cells accumulate excess Ycf4 (at least 5-fold more than required), and that reductions in Ycf4 levels do not directly correlate with PSI assembly defects .

  • Time-course analysis of assembly intermediates:

    • Method: Use pulse-chase labeling to follow the formation of assembly intermediates over time in wild-type and mutant backgrounds.

    • Interpretation: This can determine whether mutations affect the rate of assembly, the stability of intermediates, or the recruitment of specific subunits.

  • Separation of stability versus functional defects:

    • Method: Compare mutations that affect protein stability (e.g., R120A) with those affecting both stability and function (e.g., E181A).

    • Interpretation: By normalizing for protein levels, researchers can isolate the effects of mutations on Ycf4 function independent of stability issues .

  • Compensatory mutations:

    • Method: Introduce second-site mutations that restore protein stability without affecting the primary mutation of interest.

    • Interpretation: If PSI assembly is restored when protein stability is rescued, the original defect was likely due to reduced Ycf4 levels rather than loss of a specific function.

  • Domain-specific effects:

    • Method: Analyze mutations in different functional domains of Ycf4.

    • Interpretation: The data shows that mutations in the C-terminal hydrophilic domain (E181A) affect both stability and function, helping to map functional regions of the protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.