Recombinant Agrostis stolonifera Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

CP47 is essential for PSII assembly and stability:

  • Chlorophyll Binding: Binds ~14 chlorophyll molecules, with five directly ligated to histidine residues .

  • PSII Core Integration: Interacts with D1/D2 proteins and oxygen-evolving enhancer (OEE) proteins to form the PSII core complex .

  • Photoprotection: Mutations in psbB (e.g., R448G in cyanobacteria) impair PSII activity and increase photoinactivation under high light .

In Agrostis stolonifera, the recombinant psbB likely mirrors these roles, supporting PSII-mediated electron transport and oxygen evolution.

Recombinant Production and Purification

The Agrostis stolonifera psbB is produced via heterologous expression in E. coli, followed by purification:

StepDetailsSource
CloningpsbB gene inserted into bacterial expression vectors
InductionIPTG-driven expression in E. coli
PurificationAffinity chromatography (His-tag) and SDS-PAGE validation (>90% purity)
StorageLyophilized powder stored at -20°C/-80°C with 50% glycerol

Comparative Insights from Other Organisms

CP47’s conserved role across species is evident in structural and functional studies:

OrganismKey FindingsSource
SpinachFull-length recombinant psbB (1–508 AA) with His-tag validated by SDS-PAGE
CyanobacteriaR448G mutation reduces PSII activity and quantum yield .
Populus deltoidesRecombinant psbB (1–509 AA) used for studying PSII dynamics

Challenges and Future Directions

  • Limited Species-Specific Data: Most psbB studies focus on model organisms (e.g., spinach, cyanobacteria), necessitating extrapolation to Agrostis stolonifera.

  • Stability Optimization: Recombinant psbB may require cofactors (e.g., Zn-pheophytin a) for proper folding .

  • Ecological Implications: Genetic modification of Agrostis stolonifera (e.g., glyphosate tolerance) raises concerns about gene flow to wild relatives .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the initial light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure of CP47 relate to its light-harvesting function?

The CP47 protein provides a scaffold that precisely positions its 16 chlorophyll molecules in specific orientations and distances from each other. These structural arrangements determine the electronic coupling between chlorophylls and their individual excitation energies. Recent computational studies using quantum mechanics/molecular mechanics (QM/MM) approaches have identified that chlorophylls B3 and B1 in CP47 are the most red-shifted, contrary to previous hypotheses in the literature. This arrangement creates an energy landscape that facilitates directional energy transfer toward the reaction center . The protein environment provides electrostatic effects that tune the site energies of individual chlorophylls, and any structural destabilization can significantly alter light harvesting efficiency.

What expression systems are recommended for recombinant production of CP47 from Agrostis stolonifera?

For recombinant expression of membrane proteins like CP47, a combination of host systems should be considered based on experimental goals:

The choice depends on whether structural studies, functional analysis, or protein-protein interaction studies are planned.

What statistical approaches optimize recombinant CP47 expression conditions?

Instead of the traditional univariate approach (changing one variable at a time), implementing a multivariate statistical experimental design can efficiently optimize recombinant CP47 expression:

  • Factorial design: To evaluate multiple variables simultaneously (e.g., temperature, inducer concentration, media composition, induction time).

  • Fractional factorial screening design: When testing numerous variables (>4), this approach minimizes experimental runs while maintaining statistical validity.

  • Response surface methodology: To fine-tune optimal conditions after identifying significant variables.

This statistical approach allows researchers to identify not only individual variable effects but also interaction effects between variables, providing more thorough analysis with fewer experiments . For membrane proteins like CP47, key variables to optimize include:

  • Inducer concentration (IPTG: 0.1-1.0 mM)

  • Post-induction temperature (16-30°C)

  • Expression time (4-24 hours)

  • Media composition (particularly osmolytes and membrane stabilizers)

How should researchers design constructs for optimal expression of functional CP47?

Designing optimal expression constructs for CP47 requires several strategic considerations:

  • Codon optimization: Adapt the Agrostis stolonifera psbB gene codons to match the expression host's preferences to improve translation efficiency.

  • Fusion partners: Consider fusion tags that enhance membrane protein solubility and stability:

    • N-terminal fusions: MBP (maltose-binding protein) or SUMO

    • C-terminal fusions: GFP for expression monitoring and folding assessment

  • Affinity tags: Include purification tags (His6, Strep-tag II) with precise positioning to avoid interference with protein folding or function.

  • Protease cleavage sites: Engineer TEV or PreScission protease sites for tag removal during purification.

  • Signal sequences: For proper membrane targeting, either retain native transit peptides or replace with host-optimized targeting sequences.

The experimental design should include control constructs and expression monitoring via western blotting or fluorescence (if using GFP fusions) to track expression levels and solubility.

What purification strategy maximizes yield of functionally active recombinant CP47?

A methodical purification strategy for recombinant CP47 should follow these steps:

  • Membrane isolation: Differential centrifugation to isolate membrane fractions (20,000-40,000×g for collection, followed by 100,000×g for membrane pelleting).

  • Detergent screening: Systematic evaluation of detergents for solubilization efficiency while maintaining protein function:

    • Mild detergents: DDM, LMNG, or digitonin (starting concentration: 1%)

    • Solubilization time: 1-2 hours at 4°C with gentle agitation

  • Two-phase purification:

    • IMAC (Immobilized Metal Affinity Chromatography) for initial capture

    • Size-exclusion chromatography for polishing and oligomeric state assessment

  • Functional assessment: Spectroscopic methods to verify chlorophyll binding and protein folding

Throughout purification, monitor protein stability and aggregation status using dynamic light scattering or analytical ultracentrifugation to adjust buffer conditions appropriately.

How can researchers assess the structural integrity of recombinant CP47 compared to native protein?

To compare recombinant CP47 with native protein, implement a multi-technique approach:

Table 1: Comparative Spectroscopic Parameters for Native vs. Recombinant CP47

ParameterNative CP47Recombinant CP47Interpretation
Chlorophyll Qy absorption maximum674±1 nmVariable (construct-dependent)Red-shift indicates proper pigment-protein interactions
Fluorescence maximum683±2 nmVariable (construct-dependent)Longer wavelengths suggest intact energy transfer pathways
Circular dichroism (222 nm)-18,000 to -20,000 deg·cm²·dmol⁻¹Variable (prep-dependent)Reflects α-helical content integrity
Pigment binding (Chl:protein ratio)16:1Variable (typically lower)Indicates cofactor incorporation efficiency

What computational approaches can predict CP47 structure-function relationships?

Advanced computational methodologies provide valuable insights into CP47 structure-function relationships:

How can researchers investigate CP47 interactions with other PSII subunits?

To study CP47 interactions with other PSII components:

  • Crosslinking mass spectrometry (XL-MS): Utilize MS-cleavable crosslinkers (e.g., DSS, DSSO) followed by tandem mass spectrometry to identify interaction interfaces between CP47 and other PSII subunits.

  • Surface plasmon resonance (SPR): Measure binding kinetics between purified CP47 and partner proteins by immobilizing one component and flowing the other over the sensor surface.

  • Microscale thermophoresis: Quantify interaction affinities in solution using minimal sample amounts.

  • Co-immunoprecipitation with antibodies: Target either recombinant tags or native CP47 epitopes to identify interaction partners.

  • FRET-based assays: Employ site-specific fluorescent labeling to measure proximity and conformational changes during protein-protein interactions.

How does CP47 function relate to drought tolerance mechanisms in Agrostis stolonifera?

CP47 function and photosynthetic efficiency are integrally connected to drought tolerance in Agrostis stolonifera through several mechanisms:

  • ROS management: Under drought stress, impaired PSII function can lead to increased reactive oxygen species (ROS) production. Plants with optimized CP47 function may better manage excess excitation energy, reducing ROS-induced damage .

  • Cytokinin-mediated protection: Research on transgenic creeping bentgrass (Agrostis stolonifera) overexpressing cytokinin-related genes (SAG12-ipt) has demonstrated enhanced drought tolerance through improved antioxidant capacity. This may indirectly protect CP47 and other PSII components from oxidative damage .

  • Root system development: Enhanced cytokinin synthesis in creeping bentgrass promotes more extensive root development under drought conditions, which improves water acquisition capacity. This alleviates water deficit stress on photosynthetic machinery including CP47 .

  • Alternative respiratory pathways: Drought-tolerant varieties maintain higher alternative respiration rates, which can serve as an electron sink to prevent over-reduction of the photosynthetic electron transport chain during stress conditions .

What methodologies can assess CP47 protein stability under oxidative stress conditions?

To evaluate CP47 stability under oxidative stress:

  • In vitro oxidative challenge assays:

    • Expose purified CP47 to controlled H₂O₂ concentrations (0.1-10 mM)

    • Measure changes in absorption spectra, fluorescence properties, and secondary structure

    • Quantify protein carbonylation and other oxidative modifications via mass spectrometry

  • Ex vivo membrane fragment analysis:

    • Isolate thylakoid membranes containing CP47

    • Apply oxidative stress treatments (H₂O₂, paraquat, high light)

    • Assess CP47 degradation kinetics via immunoblotting

    • Measure remaining functional activity through spectroscopic methods

  • ROS visualization techniques:

    • Use histochemical staining with DAB (3-diaminobenzidine) for H₂O₂ and NBT (nitroblue tetrozolium) for superoxide detection

    • Employ fluorescent ROS sensors for subcellular localization and quantification

  • Antioxidant enzyme activity measurements:

    • Monitor changes in superoxide dismutase, catalase, peroxidase, and dehydroascorbate reductase activities in response to stress

    • Correlate enzyme activities with CP47 stability and function

How can researchers engineer CP47 to enhance photosynthetic efficiency in Agrostis stolonifera?

Strategic engineering of CP47 to improve photosynthetic efficiency should consider:

  • Site-directed mutagenesis targets:

    • Amino acids coordinating the most red-shifted chlorophylls (B3, B1) to fine-tune energy transfer

    • Residues that affect the hydrogen-bonding network around chlorophylls to optimize spectral properties

    • Protein-protein interaction interfaces to improve energy coupling with reaction center

  • Promoter manipulation strategies:

    • Use of stress-inducible or senescence-activated promoters (like SAG12) that can upregulate expression under specific conditions

    • Tissue-specific promoters to enhance expression in photosynthetically active tissues

  • Co-engineering approaches:

    • Simultaneous modification of CP47 and cytokinin synthesis (ipt gene) to combine improved energy transfer with enhanced stress tolerance

    • Coordinated engineering of multiple PSII components for synergistic effects

  • Transformation methods:

    • Agrobacterium-mediated transformation

    • Biolistic particle delivery

    • CRISPR/Cas9-mediated precise genome editing for native locus modification

Each engineering strategy should include comprehensive phenotypic analysis of transformants, including growth parameters, photosynthetic efficiency measurements, and stress tolerance assessments.

What techniques enable studying dynamic changes in CP47 during photoinhibition and repair?

To investigate CP47 dynamics during photoinhibition and repair cycles:

  • Pulse-chase labeling:

    • Use stable isotope labeling (¹⁵N, ¹³C) combined with mass spectrometry

    • Track protein synthesis, degradation, and turnover rates under various stress conditions

  • Time-resolved confocal microscopy:

    • Employ fluorescent protein fusions to visualize CP47 localization

    • Monitor real-time movement during PSII repair cycle stages

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Measure mobility of fluorescently tagged CP47 within thylakoid membranes

    • Quantify diffusion rates during stress and recovery phases

  • Immunogold electron microscopy:

    • Visualize CP47 distribution at ultrastructural level

    • Track movement between grana and stroma lamellae during repair cycle

  • In situ proximity ligation assays:

    • Detect interactions between CP47 and repair machinery components

    • Quantify spatial and temporal patterns of these interactions

These methods should be combined with photoinhibition protocols using defined light stress parameters and recovery periods to generate a comprehensive model of CP47 dynamics during PSII maintenance.

How should researchers resolve conflicting data about CP47 chlorophyll site energies?

When faced with conflicting data regarding CP47 chlorophyll site energies:

  • Methodological reconciliation:

    • Compare computational approaches (e.g., QM/MM vs. semiempirical methods) and their underlying assumptions

    • Evaluate whether different studies used comparable protein structures (crystal structure resolution, membrane environment modeling)

    • Consider if time-dependent DFT with range-separated functionals provides more accurate results than earlier computational methods

  • Experimental validation:

    • Design site-directed mutagenesis experiments targeting amino acids coordinating specific chlorophylls

    • Perform low-temperature (77K) absorption and fluorescence spectroscopy to resolve individual chlorophyll contributions

    • Use Stark spectroscopy to measure changes in dipole moment upon excitation

  • Statistical analysis framework:

    • Apply Bayesian analysis to weight conflicting data based on methodological rigor

    • Develop consensus models that accommodate seemingly contradictory results

    • Identify which aspects of conflicting models make similar predictions that can be experimentally tested

A data integration table comparing computational predictions with experimental measurements should be maintained and updated as new information becomes available.

What statistical approaches best analyze variability in recombinant protein expression data?

To effectively analyze variability in recombinant CP47 expression:

  • Design of Experiments (DoE) approach:

    • Implement factorial or fractional factorial designs to systematically evaluate multiple variables

    • Use response surface methodology to model optimal expression conditions

    • Apply ANOVA to identify statistically significant factors and interaction effects

  • Variance component analysis:

    • Partition observed variability into contributions from different sources (biological replication, technical factors, environmental conditions)

    • Calculate intraclass correlation coefficients to assess reproducibility

  • Multivariate analysis:

    • Principal component analysis (PCA) to identify patterns and correlations among multiple expression parameters

    • Hierarchical clustering to group similar experimental conditions

  • Robust statistical methods:

    • Employ non-parametric tests when data does not meet normality assumptions

    • Use bootstrapping to generate confidence intervals for expression levels

The analysis should distinguish between random variability and systematic effects to guide optimization efforts efficiently.

How might integrating CP47 research with synthetic biology approaches advance photosynthesis research?

The integration of CP47 research with synthetic biology offers several promising research directions:

  • Minimal photosystem design:

    • Identify the essential structural elements of CP47 required for function

    • Engineer simplified versions with reduced complexity but maintained function

    • Create modular PSII components that can be assembled in vitro or in heterologous systems

  • Spectral tuning:

    • Redesign chlorophyll-protein interactions to extend light absorption into new spectral regions

    • Engineer CP47 variants with altered energy transfer pathways to improve quantum efficiency

    • Create libraries of CP47 variants with distinct spectral properties for high-throughput screening

  • Biosensor applications:

    • Develop CP47-based biosensors for detecting environmental photosynthesis inhibitors

    • Create systems that report on redox state or energy transfer efficiency in real-time

  • Cross-species compatibility testing:

    • Evaluate functionality of CP47 from diverse species when expressed in Agrostis stolonifera

    • Identify evolutionary adaptations that optimize function in different environments

Each of these approaches requires establishing standardized assembly methods, characterized genetic parts, and quantitative assays for functional assessment consistent with synthetic biology principles.

What emerging technologies will advance our understanding of CP47 structure-function relationships?

Several cutting-edge technologies are poised to transform CP47 research:

  • Cryo-electron tomography:

    • Visualize CP47 in its native membrane environment at near-atomic resolution

    • Map structural heterogeneity and conformational states within intact thylakoids

  • Single-molecule spectroscopy:

    • Measure energy transfer events in individual CP47 complexes

    • Detect rare or transient conformational states masked in ensemble measurements

  • Time-resolved serial crystallography:

    • Capture structural snapshots during light-induced conformational changes

    • Track energy and electron transfer events with femtosecond temporal resolution

  • AlphaFold and other AI approaches:

    • Predict structures of CP47 variants or ancestral sequences

    • Model protein-protein interactions in the complete PSII complex

  • Genome editing platforms:

    • Prime editing and base editing for precise modification of the psbB gene

    • High-throughput mutagenesis combined with functional screening

These technologies, especially when used in combination, will provide unprecedented insights into how CP47 structure determines photosynthetic function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.