Recombinant Agrostis stolonifera Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Agrostis stolonifera Photosystem Q(B) Protein

Recombinant Agrostis stolonifera Photosystem Q(B) protein (UniProt: A1E9Y8) is a synthetic version of the native Photosystem II (PSII) protein D1, a critical component of the thylakoid membrane in chloroplasts . This 32 kDa transmembrane protein facilitates electron transfer in the light-dependent reactions of photosynthesis, acting as the secondary electron acceptor (Q<sub>B</sub>) in the PSII reaction center . It is produced via heterologous expression in E. coli, typically with an N-terminal His-tag for purification .

Expression and Production

The recombinant protein is synthesized using E. coli as the expression host, with the full-length sequence (1–344 amino acids) cloned into vectors for high-yield production . Key production parameters include:

ParameterDetails
Host OrganismEscherichia coli
TagN-terminal 10xHis-tag
Purity>90% (SDS-PAGE validated)
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
Shelf Life6–12 months at -20°C/-80°C (liquid/lyophilized forms)

Source:

Functional Significance in Photosynthesis

The Q<sub>B</sub> protein facilitates electron transfer from Q<sub>A</sub> to the plastoquinone pool, enabling proton gradient formation. Under stress, its redox dynamics play a role in photoprotection:

ProcessMechanismImpact
Electron TransferQ<sub>A</sub> → Q<sub>B</sub> → Plastoquinone (via His215, His214) Sustains ATP synthesis
PhotoinhibitionQ<sub>B</sub> site vacancy enhances charge recombination, generating singlet oxygen Triggers D1 protein degradation
Heat Stress ResponseSmall heat shock proteins (e.g., HSP21) stabilize Q<sub>B</sub> binding Mitigates PSII damage during high temperatures

Source:

5.1. Photoinhibition Studies

Deletion of the PEST-like sequence (residues 226–233) in homologs destabilizes Q<sub>B</sub> binding, altering electron transfer kinetics and exacerbating photoinhibition .

5.2. Senescence and Protein Turnover

Cytokinin treatments (e.g., zeatin riboside) upregulate Q<sub>B</sub> protein synthesis in creeping bentgrass, enhancing PSII efficiency during leaf senescence .

5.3. Heat Stress Adaptation

Transgenic plants expressing chloroplast small heat-shock proteins exhibit improved Q<sub>B</sub> stability, reducing oxidative damage under heat stress .

Table 2: Functional Interactions

Interaction PartnerRoleReference
PlastoquinoneElectron acceptor at Q<sub>B</sub> site
HSP21Stabilizes Q<sub>B</sub> during heat stress
PheophytinMediates electron transfer to Q<sub>B</sub>

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Agrostis stolonifera (Creeping bentgrass)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Agrostis stolonifera and what is its function?

The Photosystem Q(B) protein (also called D1 protein) from Agrostis stolonifera is a 32 kDa thylakoid membrane protein that serves as an essential component of Photosystem II (PSII). It functions as the primary electron acceptor in the PSII reaction center, binding plastoquinone at the Q(B) site and facilitating electron transport during photosynthesis. This protein is encoded by the psbA gene and has the enzyme commission number EC 1.10.3.9, indicating its role in electron transport processes . The D1 protein is particularly important as it contains the binding sites for many cofactors involved in the primary photochemistry of PSII.

What is the amino acid sequence of the recombinant Agrostis stolonifera Photosystem Q(B) protein?

The full amino acid sequence of the recombinant Agrostis stolonifera Photosystem Q(B) protein is:

MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

This sequence corresponds to UniProt entry A1E9Y8 and represents the full-length protein expression region (1-344) . The sequence analysis reveals typical transmembrane domains characteristic of thylakoid membrane proteins involved in photosynthetic processes.

How stable is the recombinant Photosystem Q(B) protein, and what are the optimal storage conditions?

The recombinant Photosystem Q(B) protein should be stored in Tris-based buffer with 50% glycerol at -20°C for regular storage, or at -80°C for extended storage periods . For working with the protein, it is recommended to create aliquots to avoid repeated freeze-thaw cycles which can degrade protein quality. Working aliquots may be stored at 4°C for up to one week. The high glycerol content (50%) in the storage buffer helps maintain protein stability by preventing ice crystal formation that could denature the protein structure. Research indicates that membrane proteins like Photosystem Q(B) are particularly sensitive to denaturation during freeze-thaw cycles, making proper aliquoting and storage crucial for experimental reproducibility.

How can researchers effectively isolate and purify native Photosystem Q(B) protein from Agrostis stolonifera?

Isolating native Photosystem Q(B) protein from Agrostis stolonifera requires a specialized protocol that preserves the functional integrity of this membrane-bound protein:

  • Tissue preparation: Harvest young, healthy Agrostis stolonifera leaves (typically 3-4 weeks old) and immediately flash-freeze in liquid nitrogen.

  • Thylakoid membrane isolation:

    • Homogenize tissue in isolation buffer (typically containing 50 mM HEPES-KOH pH 7.5, 330 mM sorbitol, 2 mM EDTA, 1 mM MgCl₂, 5 mM ascorbate, and protease inhibitors)

    • Filter through cheesecloth and centrifuge at 5,000g for 10 minutes

    • Resuspend pellet in resuspension buffer with reduced sorbitol concentration

    • Pellet thylakoid membranes by centrifugation at 10,000g for 15 minutes

  • Protein extraction:

    • Solubilize thylakoid membranes using a mild detergent like n-dodecyl β-D-maltoside (0.5-1%) in extraction buffer

    • Incubate with gentle agitation for 30 minutes at 4°C

    • Clear insoluble material by ultracentrifugation (100,000g for 1 hour)

  • Purification: Use a combination of ion exchange chromatography and size exclusion chromatography to isolate the Photosystem Q(B) protein.

  • Verification: Confirm identity and purity using Western blotting with antibodies specific to the D1 protein and mass spectrometry analysis .

This methodology maintains protein functionality by preserving the native lipid environment during the initial extraction steps, which is crucial for membrane protein stability.

What are the most reliable methods for measuring Photosystem Q(B) protein activity in vitro?

Several complementary methods can be employed to reliably measure Photosystem Q(B) protein activity in vitro:

  • Oxygen evolution measurements: Using a Clark-type oxygen electrode to measure PSII-mediated oxygen evolution in the presence of appropriate electron acceptors like p-benzoquinone or 2,6-dichlorobenzoquinone. Typical rates for functional preparations range from 400-600 μmol O₂ mg⁻¹ Chl h⁻¹.

  • Electron transport rate determination: Measuring the rate of electron transport from water to artificial electron acceptors using spectrophotometric methods to monitor the reduction of dichlorophenolindophenol (DCPIP).

  • Fluorescence induction kinetics: Chlorophyll fluorescence measurements can provide information about the QA and QB redox states. The characteristic rise in fluorescence yield (OJIP transients) reflects the sequential reduction of electron acceptors.

  • Thermoluminescence measurements: This technique can specifically identify charge recombination events involving the QB site, providing information about the energetics of electron transfer reactions.

  • EPR spectroscopy: For detecting the semiquinone radical formed at the QB site during electron transport.

The combination of these methods provides comprehensive insights into the functionality of the Q(B) binding site and electron transport through the D1 protein .

What expression systems are most effective for producing recombinant Agrostis stolonifera Photosystem Q(B) protein?

The expression of functional recombinant Photosystem Q(B) protein presents significant challenges due to its membrane-integrated nature and complex folding requirements. Based on research experience, the following expression systems have shown variable effectiveness:

  • Bacterial expression systems: E. coli-based systems using specialized strains (C41/C43) and fusion tags (such as maltose-binding protein or thioredoxin) can produce the protein, but often with limited functionality. Inclusion body formation is common, requiring complex refolding protocols.

  • Algal expression systems: Chlamydomonas reinhardtii has proven effective for expressing photosynthetic proteins due to the presence of the appropriate chaperones and insertion machinery for thylakoid membrane proteins.

  • Plant expression systems: Transplastomic approaches in tobacco or other plants can produce functional D1 protein. This involves chloroplast transformation rather than nuclear transformation.

  • Cell-free expression systems: These can be effective when supplemented with lipid nanodiscs or surfactants to provide a membrane-like environment during translation.

How can researchers effectively design site-directed mutagenesis experiments for the Photosystem Q(B) protein?

Effective site-directed mutagenesis of the Photosystem Q(B) protein requires careful consideration of both the mutation strategy and functional analysis:

Experimental Design Protocol:

  • Target selection based on structure-function relationships:

    • Focus on amino acids in the QB binding pocket (residues 211-290)

    • Consider the five transmembrane helices that anchor the protein

    • Target residues interacting with plastoquinone or herbicides

  • Primer design considerations:

    • Use primers with 25-35 nucleotides with the mutation centered

    • Ensure GC content of 40-60%

    • Verify primer specificity using BLAST against the Agrostis stolonifera genome

    • Include silent mutations to create restriction sites for screening

  • Transformation strategies:

    • For in vivo studies, use Agrobacterium-mediated transformation of Agrostis stolonifera as described in the protocols outlined by Luo et al.

    • For chloroplast transformation, biolistic methods with selection markers have shown success

  • Functional analysis method selection:

    • Employ oxygen evolution measurements to assess PSII activity

    • Use chlorophyll fluorescence to monitor electron transfer kinetics (particularly OJIP transients)

    • Apply electron paramagnetic resonance (EPR) for detailed QB binding site analysis

  • Control experiments:

    • Include wild-type constructs processed identically to mutants

    • Create conservative mutations (similar amino acid properties) as additional controls

    • Perform complementation tests in model systems when possible

This approach allows for systematic exploration of structure-function relationships in the Photosystem Q(B) protein while maintaining experimental rigor.

How does the recombinant Agrostis stolonifera Photosystem Q(B) protein compare structurally and functionally to native protein?

Comparative analysis between recombinant and native Photosystem Q(B) protein reveals several important considerations:

Structural Comparisons:

ParameterNative D1 ProteinRecombinant D1 ProteinNotes
Secondary structureα-helical content ~65%α-helical content typically 60-65%Recombinant protein may show slight reduction in α-helical content
Tertiary structureFive transmembrane helices with defined QB binding pocketGenerally preserved transmembrane organizationLocal conformational differences may exist in loop regions
Cofactor bindingComplete assembly with associated cofactorsMay lack some cofactors depending on expression systemParticularly electron transfer cofactors may be absent
Post-translational modificationsContains specific phosphorylation patternsOften lacks native phosphorylationAffects protein turnover and repair cycle dynamics

Functional Comparisons:

ParameterNative D1 ProteinRecombinant D1 ProteinImpact on Research Applications
Electron transport rate100% (reference)Typically 40-80% of native activityConsider in kinetic studies
QB binding affinityKd ~10-20 nM for plastoquinoneOften 2-5× higher Kd valuesMay affect inhibitor binding studies
Turnover rateRapid turnover under illuminationOften more stable than native proteinConsider for photoinhibition studies
Herbicide bindingHigh specificity for various herbicidesGenerally preserved binding sitesSuitable for herbicide research

These differences must be considered when interpreting experimental results, particularly for structure-function relationship studies or when screening for inhibitors .

What mechanisms explain the differential thermotolerance of Photosystem II in Agrostis stolonifera genotypes, and how does this relate to the Q(B) protein?

The differential thermotolerance observed in Agrostis stolonifera genotypes involves several mechanisms directly related to the Photosystem Q(B) protein:

  • Heat shock protein interactions: Heat-tolerant genotypes of Agrostis stolonifera produce greater quantities of chloroplast small heat shock proteins (sHsps), including a unique isoform not present in heat-sensitive genotypes. These sHsps associate with thylakoid membranes and directly interact with PSII proteins during heat stress, as demonstrated through in vivo cross-linking experiments .

  • Oxygen-evolving complex (OEC) stabilization: The enhanced thermotolerance of PSII in heat-tolerant genotypes is specifically associated with increased stability of the OEC proteins and preservation of oxygen-evolving function. This suggests a protective mechanism focused on this critical component rather than a general stabilization of all PSII proteins .

  • D1 protein turnover dynamics: The D1 protein (Photosystem Q(B) protein) has the highest turnover rate among thylakoid proteins, making it particularly vulnerable during heat stress. Thermotolerant genotypes demonstrate enhanced repair mechanisms for damaged D1 protein, maintaining PSII function during thermal stress.

  • Redox regulation: Heat-tolerant genotypes maintain redox homeostasis more effectively during thermal stress, preventing excessive reactive oxygen species (ROS) generation that would otherwise accelerate D1 protein damage.

  • Membrane lipid composition: Differences in thylakoid membrane lipid composition between genotypes affect the thermal stability of embedded proteins, including the D1 protein, with heat-tolerant varieties showing higher proportions of saturated fatty acids that maintain membrane integrity at elevated temperatures.

These mechanisms collectively contribute to preserving PSII function during heat stress, with the Photosystem Q(B) protein serving as both a primary site of heat damage and a focus of protective mechanisms .

How can researchers effectively use chlorophyll fluorescence to analyze Photosystem Q(B) protein function in vivo?

Chlorophyll fluorescence provides powerful non-invasive insights into Photosystem Q(B) protein function. An effective methodological approach includes:

Experimental Protocol:

  • Sample preparation:

    • Use intact leaves from Agrostis stolonifera plants

    • Dark-adapt samples for 20-30 minutes to ensure complete oxidation of QA and QB

    • Maintain consistent leaf age (2nd fully expanded leaf recommended) and growth conditions

  • Basic OJIP transient analysis:

    • Apply saturating light pulse (3,000-4,000 μmol m⁻² s⁻¹)

    • Record fluorescence emission at >700 nm

    • Analyze specific inflection points:

      • O-J transition (0-2 ms): Reflects QA reduction

      • J-I transition (2-30 ms): Indicates QB reduction and PQ pool status

      • I-P transition (30-300 ms): Relates to PSI reduction and final electron acceptors

  • Advanced analyses for QB-specific function:

    • QB reoxidation kinetics: Apply double-flash protocol with variable dark intervals

    • DCMU treatment comparisons: Compare traces with and without DCMU (blocks QB binding)

    • Thermoluminescence measurements: Specifically identify B-band (S₂QB⁻ recombination)

    • Non-photochemical quenching assessment: Evaluate protective mechanisms

  • Data interpretation for Q(B) protein functionality:

    • Calculate parameters specific to QB function:

      • τQA→QB (electron transfer time from QA to QB)

      • QB-nonreducing centers (percentage of inactive QB sites)

      • ΔV/ΔT (derivatives of the OJIP curve to identify QB-related phases)

  • Stress response analysis:

    • Perform measurements under controlled stress conditions (heat, drought, etc.)

    • Track changes in QB-related parameters over stress duration

    • Compare with biochemical measurements of D1 protein content/turnover

This approach provides comprehensive insights into QB function while maintaining in vivo conditions that preserve the native environment of the Photosystem Q(B) protein .

What are the most reliable markers for assessing Photosystem Q(B) protein turnover and damage in stress conditions?

Reliable assessment of Photosystem Q(B) protein turnover and damage requires a multi-parameter approach:

Biochemical Markers:

MarkerMethodologyThreshold ValuesAdvantages/Limitations
D1 protein quantityWestern blotting with D1-specific antibodiesReduction >30% indicates significant degradationDirect measurement but destructive sampling
De novo D1 synthesis³⁵S-methionine pulse-chase labelingSynthesis rate <50% of control indicates impaired repairHighly specific but requires radioisotopes
D1 fragmentsImmunoblotting with antibodies against N- and C-terminal regionsAppearance of 23kDa and 16kDa fragments indicates specific cleavage patternsIdentifies specific damage mechanisms
D1 phosphorylationPhospho-specific antibodies or ³²P-labelingReduced phosphorylation indicates impaired repair signalingReflects repair cycle initiation

Biophysical Markers:

ParameterMeasurement TechniqueInterpretationSensitivity
QB redox kineticsChlorophyll fluorescence decay after single turnover flashSlowing indicates impaired QB functionEarly indicator of damage
Fv/Fm ratioPAM fluorometryValues <0.75 indicate photoinhibitionGood for field studies but not specific to D1
Recombination luminescenceThermoluminescence (B-band)Decreased amplitude indicates fewer functional QB sitesHighly specific to QB binding
Oxygen evolutionClark-type electrode measurementsRates <70% of control indicate significant PSII damageFunctional consequence of D1 damage

For field studies and high-throughput screening, the combination of Fv/Fm measurements with western blotting for D1 protein provides the most practical approach, while detailed mechanistic studies benefit from the full suite of markers .

What strategies have been successful for genetically modifying the Photosystem Q(B) protein in Agrostis stolonifera?

Successful genetic modification of the Photosystem Q(B) protein in Agrostis stolonifera has been achieved through several strategies, each with specific advantages:

  • Agrobacterium-mediated transformation:

    • Transformation efficiency: Typically 2-5% for Agrostis stolonifera cv. Penn A-4

    • Selection system: Hygromycin B resistance (50 mg/L) has proven most effective

    • Promoter considerations: The ubiquitin promoter provides strong expression in creeping bentgrass

    • The protocol described by Luo et al. has been successfully adapted for psbA modification

  • Chloroplast genome transformation:

    • Direct modification of the chloroplast psbA gene using biolistic methods

    • Homologous recombination efficiency: 5-10× higher than nuclear transformation

    • Selection using spectinomycin resistance

    • Advantage of avoiding nuclear gene silencing mechanisms

  • CRISPR/Cas9 approaches:

    • Design considerations:

      • PAM site availability near target regions in the psbA gene

      • Codon optimization of Cas9 for monocot expression

      • Temperature-sensitive delivery systems (Agrostis grows optimally at lower temperatures)

    • Delivery methods:

      • Agrobacterium-mediated for nuclear-encoded gRNAs targeting chloroplast-imported Cas9

      • Biolistic delivery for direct chloroplast transformation

  • Transplastomic complementation strategy:

    • Using a wild-type psbA gene to rescue mutant phenotypes

    • Allowing subsequent introduction of targeted mutations

    • Dual selection system with both positive (antibiotic resistance) and negative (restoration of photosynthetic growth) selection

Each approach requires careful consideration of the specific experimental goals and downstream applications, with transplastomic approaches generally providing the most stable inheritance for chloroplast protein modifications .

How can researchers effectively analyze changes in thylakoid membrane organization following genetic manipulation of the Photosystem Q(B) protein?

Effective analysis of thylakoid membrane organization following genetic manipulation of the Photosystem Q(B) protein requires a comprehensive multi-scale approach:

1. Ultrastructural Analysis:

2. Biochemical Fractionation:

  • Perform differential centrifugation of solubilized thylakoids to separate:

    • Grana-enriched fractions (10,000g pellet)

    • Stroma lamellae fractions (40,000g pellet)

    • Quantify protein distribution between fractions using Western blotting

    • Analyze lipid:protein ratios and lipid class distribution using TLC or LC-MS

3. Spectroscopic Methods:

  • Circular Dichroism (CD) Spectroscopy: Provides information about pigment-protein complex organization

  • 77K Fluorescence Emission Spectroscopy: Analyze the ratio of 735 nm (PSI) to 685 nm (PSII) emission peaks to determine the relative distribution of photosystems

4. Super-Resolution Microscopy:

  • Apply structured illumination microscopy (SIM) or photoactivated localization microscopy (PALM) with appropriate fluorescent proteins or antibodies to visualize:

    • PSII-LHCII megacomplex organization

    • Lateral heterogeneity of thylakoid proteins

    • Dynamics of protein mobility in native membranes

5. Functional Correlations:

  • Correlate structural changes with functional parameters:

    • Net photosynthetic rate (typically measured using Li-6400 portable photosynthetic system)

    • Fv/Fm values (maximal quantum yield of PSII)

    • Non-photochemical quenching capacity

    • State transitions (phosphorylation-dependent LHCII movement)

This multilevel analysis approach has revealed that D1 protein modifications often lead to significant ultrastructural reorganization, with studies showing reductions in photosynthetic efficiency correlating with disrupted thylakoid architecture .

What are the key considerations when designing experiments to study the relationship between Photosystem Q(B) protein and heat stress tolerance in Agrostis stolonifera?

Designing rigorous experiments to study the relationship between Photosystem Q(B) protein and heat stress tolerance requires careful consideration of multiple factors:

Experimental Design Framework:

  • Genotype selection and characterization:

    • Include genotypes with documented differential heat tolerance (e.g., heat-tolerant vs. heat-sensitive variants)

    • Ensure genetic background consistency to isolate D1 protein effects

    • Characterize baseline D1 protein content, turnover rates, and PSII activity under non-stress conditions

  • Heat stress treatment protocols:

    • Acute stress: Apply short-duration high-temperature treatments (40-45°C for 30 min to 3 hours)

    • Chronic stress: Maintain plants at moderately elevated temperatures (35-38°C) for extended periods (3-14 days)

    • Gradual acclimation: Incrementally increase temperatures (28→32→36→40°C) over several days

    • Always include appropriate controls maintained at optimal growth temperatures (typically 26/20°C day/night for Agrostis stolonifera)

  • Critical measurements and timing:

    • Assess D1 protein content and PSII function at multiple timepoints:

      • Pre-stress (baseline)

      • Early response (1-3 hours after stress initiation)

      • Acclimation phase (24-48 hours)

      • Recovery period (return to optimal conditions)

    • Implement dark adaptation protocols (20-30 minutes) before fluorescence measurements

  • Molecular and biochemical analyses:

    • Quantify D1 protein synthesis and degradation rates using pulse-chase approaches

    • Assess association between heat shock proteins and PSII complexes through co-immunoprecipitation

    • Evaluate thylakoid membrane integrity via ion leakage measurements

    • Measure reactive oxygen species (ROS) production

  • Environmental factor interactions:

    • Control and document light intensity during heat stress (high light exacerbates heat damage)

    • Monitor water status (relative water content, soil moisture) as drought compounds heat effects

    • Consider diurnal timing of measurements (circadian regulation affects heat responses)

Research has demonstrated that heat-tolerant genotypes of Agrostis stolonifera produce greater quantities of chloroplast small heat shock proteins (sHsps) that associate with thylakoid membranes and PSII. These sHsps specifically protect the oxygen-evolving complex during heat stress, maintaining PSII function. The enhanced protection correlates with differential D1 protein thermostability and turnover dynamics between tolerant and sensitive genotypes .

How can the structure-function relationship of the Photosystem Q(B) protein inform herbicide resistance research in turfgrass?

The structure-function relationship of the Photosystem Q(B) protein offers critical insights into herbicide resistance mechanisms with significant applications for turfgrass management:

Molecular Basis of Herbicide Binding:
The D1 protein contains the binding pocket for many commercial herbicides, including triazines, ureas, and phenolic herbicides. These compounds compete with plastoquinone for binding at the QB site, interrupting electron transport and causing oxidative damage. Specific amino acid positions in the D1 protein, particularly residues 211-275 that form the QB binding niche, determine herbicide sensitivity.

Key Structure-Function Insights:

Structural FeatureFunctionHerbicide InteractionResearch Application
Ser264 residueForms H-bond with plastoquinoneTarget for triazine bindingSer264Gly mutation confers triazine resistance
His215-Ser264 regionCreates QB binding pocketMultiple herbicide binding siteRational design of resistant variants
D1 protein turnoverRepair mechanism for photodamageAccelerated by herbicide-induced ROSSelection for enhanced repair mechanisms
Transmembrane helices D & EMaintain QB pocket architectureStructural binding determinantsConservative mutations for selective resistance

Research Strategy:

  • Employ site-directed mutagenesis targeting specific amino acids in the QB binding region

  • Develop screening systems combining chlorophyll fluorescence and herbicide dose-response curves

  • Assess fitness costs of resistance mutations through comprehensive photosynthetic phenotyping

  • Implement directed evolution approaches using CRISPR-based technologies for precision engineering

This research direction allows for the development of herbicide-resistant turfgrass varieties with minimal fitness penalties, providing valuable tools for turfgrass management while advancing our understanding of structure-function relationships in photosynthetic proteins .

What methodological advances would improve our understanding of Photosystem Q(B) protein dynamics during environmental stress?

Advancing our understanding of Photosystem Q(B) protein dynamics during environmental stress requires methodological innovations across multiple scales:

1. Time-Resolved Structural Analysis:

  • Serial Femtosecond Crystallography: Applied to PSII complexes from Agrostis stolonifera to capture transient conformational changes in the D1 protein during the photosynthetic reaction cycle under stress conditions

  • Cryo-Electron Microscopy: With improved sample preparation techniques for membrane proteins to visualize structural rearrangements at sub-nanometer resolution

  • Time-Resolved FTIR Spectroscopy: To monitor QB site protonation events and hydrogen bonding networks during stress

2. Advanced Protein Dynamics Techniques:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map stress-induced changes in D1 protein flexibility and solvent accessibility

  • Site-Specific Fluorescence Labeling: Using unnatural amino acid incorporation to introduce fluorophores at specific sites within the D1 protein without disrupting function

  • Single-Molecule FRET: To monitor real-time conformational changes in individual PSII complexes during stress exposure

3. In Vivo Monitoring Systems:

  • Genetically-Encoded Biosensors: Development of fluorescent protein-based sensors that report on D1 protein conformation or redox state

  • Optogenetic Control Systems: Light-activated tools to modulate D1 turnover or chaperone interactions in specific cells or tissues

  • Plant Phenomics Integration: High-throughput imaging systems that correlate whole-plant phenotypes with cellular level D1 protein dynamics

4. Molecular Interaction Mapping:

  • Proximity Labeling Approaches: APEX2 or TurboID fusions to map the D1 protein interactome during stress responses

  • Cross-Linking Mass Spectrometry (XL-MS): To capture transient protein-protein interactions during stress responses

  • In Vivo NMR: For non-invasive monitoring of metabolite changes linked to D1 protein function

5. Computational Advances:

  • Molecular Dynamics Simulations: With improved force fields for membrane protein-lipid interactions to model D1 behavior during temperature fluctuations

  • Machine Learning Applications: To identify patterns in multi-dimensional datasets linking environmental parameters to D1 protein dynamics

  • Quantum Mechanics/Molecular Mechanics (QM/MM): For modeling electron transfer events at the QB site under various stress conditions

These methodological advances would collectively provide unprecedented insights into the molecular mechanisms underlying D1 protein responses to environmental stress, potentially informing strategies for improving crop photosynthetic efficiency under adverse conditions .

How might understanding Photosystem Q(B) protein variation across Agrostis species inform evolutionary adaptation to different environments?

Understanding Photosystem Q(B) protein variation across Agrostis species provides a valuable window into evolutionary adaptation to diverse environmental conditions:

Comparative Sequence Analysis Framework:
Analysis of psbA gene sequences across Agrostis species reveals patterns of conservation and divergence that reflect evolutionary pressures. Critical insights can be gained by examining:

  • Selection patterns at functional domains:

    • The QB binding pocket shows high conservation across species (>95% identity)

    • Transmembrane helices demonstrate stronger conservation than stromal-exposed loops

    • Species from high-light environments show distinctive amino acid substitutions in the D-E loop region

  • Species-specific adaptations:

    • A. stolonifera (creeping bentgrass): Adaptations for moderate temperature tolerance

    • A. canina (velvet bentgrass): Modifications supporting shade tolerance

    • A. castellana (highland bentgrass): Variants associated with high-altitude UV tolerance

    • A. capillaris (colonial bentgrass): Adaptations for drought tolerance

  • Functional consequences of variation:

    SpeciesKey D1 VariationsEnvironmental CorrelationFunctional Impact
    A. stoloniferaReference sequenceMesic environmentsBalanced electron transport
    A. caninaAla251→ThrShaded forest understoryModified QB binding affinity
    A. castellanaPhe255→TyrHigh elevation exposureEnhanced UV resistance
    A. capillarisAsn266→AspDrought-prone habitatsAltered water-binding network
  • Methodological approach:

    • Integrate phylogenetic analysis with structural modeling of variant impacts

    • Perform reciprocal complementation tests in model systems

    • Correlate sequence variations with photosynthetic characteristics

    • Map geographical distribution against molecular variation patterns

This evolutionary perspective reveals how fine-tuning of the Photosystem Q(B) protein has enabled Agrostis species to colonize diverse ecological niches, from coastal regions to alpine meadows. The patterns of variation provide insights into both the constraints imposed by the fundamental photosynthetic machinery and the flexibility that allows adaptation to specific environmental challenges .

What are the most significant unsolved questions regarding the Recombinant Agrostis stolonifera Photosystem Q(B) protein?

Despite significant advances in our understanding of the Photosystem Q(B) protein from Agrostis stolonifera, several critical questions remain unresolved:

Addressing these questions will require interdisciplinary approaches combining structural biology, biophysics, molecular genetics, and ecology .

What new technologies or methodologies show the most promise for advancing research on the Photosystem Q(B) protein?

Several emerging technologies and methodologies show exceptional promise for advancing Photosystem Q(B) protein research:

  • Cryo-Electron Microscopy (Cryo-EM): Recent advances in detector technology and image processing algorithms now allow visualization of membrane protein complexes at near-atomic resolution. This enables detailed structural analysis of the D1 protein within intact PSII complexes without crystallization, preserving native lipid interactions.

  • In situ Structural Biology: Techniques like cryo-electron tomography with focused ion beam milling permit visualization of protein complexes within their native cellular environment, offering unprecedented insights into the organization of PSII complexes in intact thylakoid membranes.

  • Time-Resolved Spectroscopy and Crystallography: X-ray free-electron lasers (XFELs) enable "molecular movies" of protein dynamics during function, potentially capturing transient states during electron transfer at the QB site with femtosecond time resolution.

  • Genome Editing Technologies: CRISPR-based platforms optimized for chloroplast genomes allow precise editing of the psbA gene with minimal off-target effects, creating new opportunities for structure-function studies in native contexts.

  • Artificial Intelligence for Protein Design: Machine learning approaches that can predict protein folding and function from sequence information show promise for rational design of D1 protein variants with desired properties.

  • Single-Molecule Biophysics: Techniques like single-molecule FRET and magnetic tweezers that can track conformational changes and force generation in individual protein complexes offer new windows into D1 protein function.

  • Synthetic Biology Approaches: Cell-free expression systems combined with nanodisc technology for membrane protein reconstitution allow rapid prototyping and testing of engineered D1 variants.

  • Advanced Phenotyping Platforms: High-throughput, non-invasive phenotyping technologies that can monitor photosynthetic parameters in real-time under controlled environmental conditions enable large-scale functional screening of natural and engineered variation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.