Recombinant Ailuropoda melanoleuca E3 ubiquitin-protein ligase RNF152 (RNF152)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RNF152; PANDA_005868; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Ailuropoda melanoleuca (Giant panda)
Target Names
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVAQLPDDPEVLAVIAIPHASEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCR LLPGSQQKSVTVVTVPAEQRPLQGGAPQEAVEEEPDRRGVAKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function

RNF152 is an E3 ubiquitin-protein ligase that mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation. This regulates mTORC1 signaling and influences cellular responses to amino acid availability. It also mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation. Overexpression of RNF152 induces apoptosis.

Database Links
Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of RNF152 in giant pandas?

RNF152 is a RING finger protein with E3 ubiquitin ligase activity. Based on studies in other mammals, giant panda RNF152 likely contains:

  • A canonical RING finger domain with characteristic cysteine and histidine residues that coordinate zinc ions

  • A transmembrane domain that anchors the protein to lysosomal membranes

  • Sites for auto-ubiquitination and post-translational modifications

Functionally, RNF152 serves multiple roles:

  • Acts as a lysosome-localized E3 ubiquitin ligase with pro-apoptotic activity

  • Regulates mTORC1 signaling in response to amino acid availability through RagA ubiquitination

  • Positively regulates TLR/IL-1R signaling by facilitating MyD88 oligomerization

Experimental approaches to characterize giant panda RNF152 structure should include comparative sequence analysis with well-studied mammalian orthologs, followed by recombinant protein expression and structural determination via X-ray crystallography or NMR for domain-specific analysis.

How does giant panda RNF152 localize within cells?

RNF152 in giant pandas likely exhibits specific subcellular localization patterns similar to those observed in other mammals:

  • Primary localization at lysosomal membranes, where it co-localizes with lysosomal markers such as LAMP3

  • This lysosomal localization is dependent on its transmembrane domain

  • The RING finger domain likely extends into the cytosol, allowing interaction with ubiquitination machinery and substrates

To experimentally determine RNF152 localization in giant panda cells:

  • Isolate primary fibroblasts from giant panda tissue samples

  • Perform immunofluorescence microscopy using antibodies against RNF152 and lysosomal markers

  • Validate with subcellular fractionation followed by western blot analysis

  • Create truncation mutants to confirm the role of the transmembrane domain in localization

Conservation of lysosomal localization across species suggests functional importance in nutrient sensing and apoptotic regulation, which may be particularly relevant given the giant panda's specialized bamboo diet and unique digestive adaptations.

What evolutionary conservation exists for RNF152 among ursids and other mammals?

RNF152 appears to be evolutionarily conserved across mammals, with implications for understanding giant panda biology:

  • Functional domains (RING finger and transmembrane domains) show high conservation across mammalian species

  • Substrate specificity, particularly for RagA ubiquitination, appears to be preserved across diverse species

  • Conservation suggests fundamental importance in cellular homeostasis and signaling pathways

Research approach for comparative analysis:

  • Extract RNF152 sequences from the giant panda genome database (from the 612-panda genome sequencing project)

  • Perform phylogenetic analysis comparing RNF152 across ursids and other mammals

  • Calculate selection pressures on different protein domains to identify potential adaptive changes

  • Correlate molecular evolution with ecological adaptations, particularly focusing on the giant panda's dietary specialization

What are the optimal expression systems for producing recombinant giant panda RNF152?

Selection of expression systems for recombinant Ailuropoda melanoleuca RNF152 production requires consideration of protein characteristics and experimental goals:

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coli- High yield
- Simple protocol
- Low cost
- Challenges with membrane proteins
- Lacks mammalian PTMs
- RING domain fragments
- Activity assays
- Antibody production
Yeast- Eukaryotic PTMs
- High yield
- Moderate cost
- Some differences in glycosylation
- May require codon optimization
- Full-length protein
- Structural studies
- In vitro assays
Baculovirus- Near-native PTMs
- Good for membrane proteins
- High expression
- Higher cost
- Technical complexity
- Longer timeframe
- Functional studies
- Full-length transmembrane domain
- Interaction studies
Mammalian- Native-like PTMs
- Proper folding
- Authentic activity
- Highest cost
- Lower yields
- Most complex protocol
- Signaling studies
- Activity in cellular context
- Complex interactions

Methodological approach:

  • Clone the RNF152 coding sequence from giant panda cDNA

  • For full-length protein with transmembrane domain, prioritize eukaryotic systems (particularly baculovirus or mammalian)

  • For RING domain alone, E. coli expression is sufficient and cost-effective

  • Incorporate affinity tags (His, GST) for purification while confirming they don't interfere with activity

  • Validate protein folding with circular dichroism and activity assays

Researchers should select the system that best aligns with their specific experimental requirements and resources.

How can I design experiments to determine the E3 ligase activity of giant panda RNF152?

To robustly characterize the E3 ligase activity of giant panda RNF152:

  • In vitro ubiquitination assays:

    • Components: Purified recombinant RNF152, E1 (UBA1), E2 enzymes (multiple candidates including UBE2D family), ubiquitin, ATP

    • Controls: Include catalytically inactive RNF152 mutant (C30S mutation in RING domain)

    • Detection: Western blot using anti-ubiquitin antibodies

    • Analysis: Compare wild-type vs. C30S mutant auto-ubiquitination patterns

  • Linkage-specificity determination:

    • Use ubiquitin mutants (K48R, K63R) to determine chain-type preferences

    • Apply linkage-specific antibodies to detect K48 vs. K63 polyubiquitin chains

    • Mass spectrometry analysis of ubiquitin chain topology

    • Compare with known RNF152 K63-linkage preference for RagA ubiquitination

  • Substrate validation:

    • Test ubiquitination of known substrates (RagA) from giant panda

    • Perform co-immunoprecipitation to identify novel interaction partners

    • Validate candidates with in vitro and cellular ubiquitination assays

    • Compare substrate specificity with human RNF152

These methodologies will establish whether giant panda RNF152 exhibits E3 ligase activity comparable to other mammalian orthologs, while potentially identifying unique aspects of its function in this species.

What cellular models are most appropriate for studying giant panda RNF152 function?

Selecting appropriate cellular models for giant panda RNF152 research requires balancing physiological relevance with experimental feasibility:

  • Primary giant panda cells:

    • Fibroblasts derived from skin biopsies of zoo specimens

    • Peripheral blood mononuclear cells (PBMCs) for immune function studies

    • Advantages: Most physiologically relevant; authentic cellular context

    • Limitations: Limited availability; ethical considerations; challenging to manipulate genetically

  • Cell lines with reconstituted expression:

    • Human or mouse cell lines with CRISPR/Cas9 knockout of endogenous RNF152

    • Transfection with giant panda RNF152 expression constructs

    • Suitable cell types: HeLa (used successfully for human RNF152 apoptosis studies) , HEK293T, mouse embryonic fibroblasts (MEFs)

    • Advantages: Controlled expression; genetic manipulation; comparative studies with other species

    • Limitations: Potential artifacts in heterologous systems

  • Function-specific considerations:

    • For lysosomal and mTORC1 studies: Cells responsive to nutrient starvation

    • For immune signaling: Macrophage-like cells to study TLR/IL-1R pathways

    • For apoptosis: Cell lines with well-characterized apoptotic machinery

  • Validation approaches:

    • Confirm expression using species-specific antibodies or epitope tags

    • Verify subcellular localization using confocal microscopy

    • Assess functional readouts relevant to known RNF152 activities

The research question, available resources, and ethical considerations should guide the selection of the most appropriate cellular model.

How can researchers assess the role of RNF152 in TLR/IL-1R signaling in giant panda cells?

To investigate RNF152's role in TLR/IL-1R signaling in giant pandas:

  • Expression analysis:

    • Quantify RNF152 expression in giant panda immune cells using RT-qPCR

    • Examine regulation following stimulation with TLR ligands (LPS, PGN) and IL-1β

    • Compare with expression patterns in other species

  • Functional assessment in cellular models:

    • Generate RNF152 knockdown in giant panda cells using siRNA/shRNA

    • Alternative approach: Express giant panda RNF152 in RNF152-deficient mouse or human cells

    • Stimulate with TLR ligands (LPS for TLR4, PGN for TLR2) or IL-1β

    • Measure:

      • Pro-inflammatory cytokine production (IL-1β, IL-6, CXCL10, TNFα)

      • Activation of signaling components (phosphorylation of IKKα/β, p38)

      • NF-κB nuclear translocation and target gene transcription

  • Molecular mechanism investigation:

    • Assess MyD88 oligomerization status using gel filtration chromatography

    • Examine IRAK1 recruitment to MyD88 by co-immunoprecipitation

    • Determine if the E3 ligase activity is dispensable using catalytically inactive mutants (C30S, ΔRING)

    • Evaluate membrane localization requirements using transmembrane domain mutants (ΔTM)

This methodology will reveal whether giant panda RNF152 functions similarly to other mammalian orthologs in immune signaling, potentially identifying species-specific adaptations in immune regulation.

How does RNF152 regulate mTORC1 signaling in response to nutrients in giant pandas?

RNF152's role in nutrient sensing and mTORC1 regulation has particular relevance for giant pandas given their specialized bamboo diet:

  • Mechanism based on studies in other mammals:

    • Under amino acid starvation, RNF152 mediates K63-linked polyubiquitination of RagA

    • This modification prevents RagA from recruiting mTORC1 to lysosomes

    • Consequently, mTORC1 activity is inhibited, reducing protein synthesis and promoting autophagy

  • Experimental approach for giant panda cells:

    • Culture cells under varying amino acid concentrations

    • Assess RNF152-RagA interaction and RagA ubiquitination status

    • Measure mTORC1 activity via phosphorylation of downstream targets (S6K, 4E-BP1)

    • Compare dynamics with those in omnivorous mammals

  • Potential adaptations in giant pandas:

    • Giant pandas consume a bamboo diet despite having a carnivore's digestive system

    • RNF152-mediated nutrient sensing may be adapted to optimize metabolism under this specialized diet

    • Unique amino acid threshold responses might exist to accommodate the nutrient profile of bamboo

  • Conservation implications:

    • Understanding metabolic regulation may inform ex situ feeding strategies

    • Could provide insights into the metabolic aspects of giant panda adaptation to captivity

    • May have relevance for diseases related to metabolic dysregulation

This research direction explores the molecular underpinnings of the giant panda's remarkable dietary adaptation and may have practical applications for conservation management.

What is the role of RNF152 in lysosome-mediated apoptosis in giant pandas?

RNF152's identification as the first E3 ligase involved in lysosome-related apoptosis warrants investigation in giant pandas:

  • Apoptotic mechanism investigation:

    • Overexpress wild-type and mutant (C30S, ΔTM) giant panda RNF152 in cell models

    • Measure apoptotic markers (caspase activation, PARP cleavage, phosphatidylserine externalization)

    • Assess lysosomal membrane permeabilization using LysoTracker or cathepsin release assays

    • Determine whether E3 ligase activity is required by comparing wild-type vs. C30S mutant

  • Regulatory framework:

    • Identify conditions that modulate RNF152 expression or activity in giant panda cells

    • Examine relationship with other apoptotic pathways (mitochondrial, death receptor)

    • Investigate cross-talk with mTORC1 signaling and autophagy pathways

  • Species-specific considerations:

    • Compare sensitivity to RNF152-induced apoptosis between giant panda cells and other mammals

    • Investigate potential adaptations in apoptotic machinery related to the giant panda's unique physiology

    • Examine tissue-specific expression patterns and their correlation with tissue turnover rates

  • Conservation applications:

    • Understanding cellular homeostasis mechanisms in giant pandas

    • Potential implications for ex vivo culture of giant panda cells for conservation purposes

    • Insights into cell survival under stress conditions relevant to habitat challenges

This research area connects fundamental cell biology with species-specific adaptations and may yield insights relevant to giant panda conservation efforts.

How can advanced proteomics approaches identify novel substrates of giant panda RNF152?

Implementing state-of-the-art proteomics to discover RNF152 substrates in giant pandas:

  • Global ubiquitinome analysis:

    • Compare ubiquitinated protein profiles in cells with wild-type vs. depleted RNF152

    • Use SILAC or TMT labeling for quantitative comparison

    • Enrich ubiquitinated peptides using K-ε-GG antibodies

    • Focus on K63-linked ubiquitination events based on RNF152's known preference

  • Proximity-dependent labeling:

    • Generate BioID or TurboID fusion with RNF152

    • Express in giant panda cells or appropriate model system

    • Identify proteins in proximity to RNF152 at lysosomes

    • Validate candidate substrates with direct ubiquitination assays

  • Comparative interactome mapping:

    • Immunoprecipitate RNF152 from cells under different conditions (nutrient replete/starved, TLR stimulated/unstimulated)

    • Identify differential interactors using mass spectrometry

    • Compare with known substrates (RagA) and interactors (MyD88)

    • Validate using reciprocal co-immunoprecipitation

  • Functional validation pipeline:

    • Test direct ubiquitination in vitro with recombinant proteins

    • Confirm ubiquitination in cells with ubiquitin mutants (K48R, K63R)

    • Assess functional consequences of substrate ubiquitination

    • Determine conservation of novel substrates across mammalian species

This comprehensive approach may identify substrates unique to giant pandas, potentially revealing molecular adaptations specific to their ecological niche.

What is the relationship between RNF152 function and giant panda conservation genetics?

Investigating RNF152 from a conservation genomics perspective:

  • Genetic variation analysis:

    • Leverage data from the 612 giant panda genome sequencing project

    • Identify polymorphisms in RNF152 coding and regulatory regions

    • Compare variation across the six mountain range populations

    • Assess whether RNF152 shows signatures of selection in giant pandas

  • Population-specific variants:

    • Examine whether isolated populations (particularly Qinling and Liangshan, identified as conservation priorities) show unique RNF152 variants

    • Assess functional implications of population-specific variants

    • Correlate with population health indicators and environmental factors

  • Experimental validation:

    • Express population-specific RNF152 variants in cellular models

    • Compare activity in lysosomal, mTORC1, and immune signaling pathways

    • Assess potential impacts on cellular resilience to stress

  • Conservation applications:

    • Inform genetic management strategies for captive breeding programs

    • Consider RNF152 variation in selecting individuals for release programs

    • Apply insights to understand potential physiological differences between populations

This research direction connects molecular function with conservation genetics, potentially contributing to the scientific foundation for giant panda preservation strategies.

How does giant panda RNF152 differ functionally from RNF152 in other mammals?

Comparative functional analysis between giant panda RNF152 and orthologs from other mammals:

  • Cross-species activity comparison:

    • Express recombinant RNF152 from giant panda, human, mouse, and other bear species

    • Compare:

      • Auto-ubiquitination efficiency and chain-type preference

      • Substrate specificity and ubiquitination patterns

      • Ability to regulate mTORC1 and TLR/IL-1R signaling

    • Assess functional complementation in RNF152-deficient cells from different species

  • Domain swap experiments:

    • Create chimeric proteins exchanging domains between giant panda and human RNF152

    • Identify regions responsible for species-specific functional differences

    • Focus on regions outside the highly conserved RING and transmembrane domains

  • Regulatory divergence:

    • Compare transcriptional and post-translational regulation across species

    • Assess response to stimuli (nutrient availability, immune activators) in different species

    • Examine subcellular localization patterns for potential differences

  • Adaptive significance:

    • Correlate functional differences with ecological adaptations

    • Consider the giant panda's unique dietary specialization and habitat requirements

    • Examine whether differences align with giant panda's evolutionary history and carnivore ancestry

This comparative approach may reveal how RNF152 has potentially adapted to support the giant panda's unusual metabolism and immune function within its specialized ecological niche.

What insights can comparative genomics provide about RNF152 evolution in Ursidae?

Leveraging comparative genomics to understand RNF152 evolution within bears:

  • Phylogenetic analysis across Ursidae:

    • Compare RNF152 sequences from all eight extant bear species

    • Reconstruct ancestral sequences to track evolutionary changes

    • Calculate selection pressures (dN/dS ratios) on different protein domains

    • Identify bear-specific amino acid substitutions

  • Correlation with ecological adaptations:

    • Compare RNF152 sequences between dietary specialists (giant panda, polar bear) and generalists (brown bear, American black bear)

    • Assess whether molecular changes correlate with dietary adaptations

    • Consider the transition from carnivory to herbivory in the giant panda lineage

  • Regulatory evolution:

    • Analyze promoter and enhancer regions across ursid species

    • Identify potential changes in transcription factor binding sites

    • Compare expression patterns in homologous tissues across bear species

  • Functional validation:

    • Express ancestral and extant RNF152 variants in cellular models

    • Test activity in nutrient sensing, immune regulation, and apoptosis pathways

    • Assess whether giant panda-specific substitutions alter function

This evolutionary perspective may provide valuable insights into the molecular basis of ursid adaptations to different ecological niches, particularly the giant panda's remarkable dietary specialization.

How does RNF152 contribute to the unique metabolic adaptations of giant pandas?

Investigating RNF152's potential role in the giant panda's peculiar metabolic adaptation:

  • Nutrient sensing comparison:

    • Compare RNF152-mediated mTORC1 regulation between giant pandas and other bears

    • Assess sensitivity to amino acid fluctuations in cells expressing panda vs. other mammalian RNF152

    • Determine whether the threshold for RNF152 activation by nutrient starvation differs in giant pandas

  • Bamboo adaptation relevance:

    • Giant pandas consume a bamboo diet despite having a carnivore's digestive system

    • Analyze whether RNF152 regulation of metabolism has adapted to optimize nutrient utilization from bamboo

    • Investigate potential connections to the giant panda's unique feeding cycles and bamboo part selection

  • Experimental approaches:

    • Culture cells in media mimicking nutrient profiles of bamboo vs. carnivore diets

    • Assess differential activation of RNF152-dependent pathways

    • Compare autophagy induction thresholds across species

    • Measure cellular energy homeostasis under different nutrient conditions

  • Conservation implications:

    • Understanding metabolic regulation may inform ex situ feeding strategies

    • Could provide insights into the metabolic health of captive vs. wild giant pandas

    • May have relevance for diseases related to metabolic dysregulation in captive specimens

This research direction explores the molecular underpinnings of the giant panda's remarkable dietary adaptation and may have practical applications for conservation management.

What role might RNF152 play in giant panda immune function and disease resistance?

Exploring RNF152's contribution to giant panda immunobiology:

  • Immune signaling regulation:

    • Compare TLR/IL-1R pathway activation in cells expressing giant panda vs. other mammalian RNF152

    • Assess cytokine production profiles in response to various microbial stimuli

    • Determine whether giant panda RNF152 uniquely regulates specific immune pathways

  • Infection response patterns:

    • Investigate RNF152 expression regulation during simulated infections

    • Compare with regulation patterns in other species

    • Assess whether giant panda RNF152 shows adaptations related to bamboo-associated microbes or pathogens

  • Conservation health implications:

    • Analyze RNF152 genetic variants across giant panda populations in relation to disease occurrence

    • Consider how RNF152's immune functions might impact susceptibility to emerging diseases

    • Investigate potential connections to known health challenges in captive and wild populations

  • Experimental approaches:

    • Challenge giant panda cells (or cells expressing giant panda RNF152) with relevant pathogens

    • Compare immune responses with cells expressing RNF152 from other species

    • Use CRISPR/Cas9 to generate RNF152 variants mimicking natural polymorphisms

    • Assess functional consequences for immune signaling and pathogen clearance

Understanding these immune regulatory functions is particularly relevant for giant panda conservation, as it may provide insights into population-specific disease susceptibility and resistance patterns.

What are the most promising future research directions for giant panda RNF152?

The study of RNF152 in giant pandas represents a convergence of molecular biology, comparative genomics, and conservation science. The most promising research directions include:

  • Integration of RNF152 genetics with conservation management:

    • Using knowledge of RNF152 variants to inform breeding programs

    • Applying insights from population genomics to enhance genetic rescue strategies

    • Correlating RNF152 function with physiological adaptations to captive environments

  • Mechanistic studies of species-specific adaptations:

    • Detailed investigation of nutrient sensing adaptations related to the bamboo diet

    • Comparative analysis of immune regulation across bear species

    • Structure-function studies examining giant panda-specific protein features

  • Development of giant panda-specific research tools:

    • Generation of cell lines and primary culture systems

    • Production of specialized antibodies and recombinant proteins

    • Creation of in vitro assay systems relevant to giant panda biology

  • Translation to conservation practice:

    • Application of molecular insights to health monitoring programs

    • Development of non-invasive biomarkers based on RNF152 pathway activity

    • Integration of molecular data with ecological and behavioral studies

This multi-disciplinary approach promises to advance both fundamental understanding of giant panda biology and practical applications for conservation management of this iconic endangered species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.