Recombinant Ailuropoda melanoleuca E3 ubiquitin-protein ligase RNF182 (RNF182)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Ailuropoda melanoleuca E3 ubiquitin-protein ligase RNF182 (RNF182) is an enzyme that, in humans, is encoded by the RNF182 gene . RNF182 is a brain-enriched E3 ubiquitin ligase that stimulates E2-dependent polyubiquitination in vitro . As an E3 ubiquitin ligase, RNF182 plays a role in the ubiquitin-proteasome pathway, which is responsible for protein degradation, and has implications in diseases such as Alzheimer's and cancer .

Structure and Properties

  • RNF182 is a cytoplasmic protein that contains a RING finger domain, a characteristic motif found in E3 ubiquitin ligases . The RING finger domain in human RNF182 is located between amino acids C20 and C67 .

  • The primary structure of RNF182 also suggests the presence of two putative transmembrane helices located at the C-terminus, specifically spanning amino acids 178 to 200 and 212 to 234, respectively . Within these transmembrane domains, there are four leucine repeats between amino acids 197 and 225, though they do not form a leucine zipper .

  • Human RNF182 exhibits high sequence homology to rodent RNF182 proteins, sharing 98% and 97% sequence identity with mouse and rat, respectively .

  • RNF182 catalyzes 'Lys-48'-linked polyubiquitination in vitro .

Expression and Tissue Distribution

  • RNF182 is expressed preferentially in the brain . Studies show its presence in the mouse cortex, hippocampus, cerebellum, and spinal cord, but not in the heart, liver, kidney, or skeletal muscle .

  • Quantitative RT-PCR analysis has indicated that RNF182 is upregulated during retinoic acid (RA)-induced differentiation of human NT2 cells, with increased levels of RNF182 transcripts detected in both NT2 neurons and NT2 astrocytes .

  • RNF182 expression is decreased in non-small cell lung cancer (NSCLC) tissues, including lung adenocarcinoma (LUAD) and lung squamous cell carcinoma (LUSC), compared to normal tissues .

Functional Studies

  • RNF182 possesses E3 ubiquitin ligase activity and stimulates E2-dependent polyubiquitination in vitro . It mediates the ubiquitination of ATP6V0C, targeting it for degradation via the ubiquitin-proteasome pathway .

  • Overexpression of RNF182 can reduce cell viability, suggesting that it can disrupt cellular homeostasis .

  • RNF182 induces p65 ubiquitination, suppressing PDL1 transcription and immunosuppression in LUAD .

Role in Disease

  • RNF182 expression is elevated in post-mortem Alzheimer's disease (AD) brain tissue and can be upregulated in vitro in cultured neurons subjected to cell death-inducing injuries .

  • Inhibition of RNF182, mediated by Bap, promotes lung cancer tumorigenesis through activating AhR and promoting abnormal methylation .

  • Low expression of RNF182 is associated with poor survival in LUAD and lung cancer patients .

  • RNF182 is upregulated not only in neuronal cells subjected to cell death-inducing injuries but also in AD brains where neurodegeneration has become evident .

RNF182 and Cancer

RNF182 has been found to be associated with non-small cell lung cancer .

FeatureFinding
Expression in NSCLCSignificantly decreased in LUAD and LUSC tissues compared to normal tissues
mRNA and Protein LevelsReduced in NSCLC tumor tissues compared to adjacent normal tissues
Prognosis in LUADLow RNF182 expression associated with poorer survival
MethylationIncreased methylation of RNF182 CpG sites in tumor tissues, leading to reduced expression
p65 UbiquitinationInduces p65 ubiquitination, suppressing PDL1 transcription and immunosuppression in LUAD
Clinical Features CorrelationHigh RNF182 expression correlates with T1 stage, N0 stage, and M0 stage, indicating less advanced tumors; low expression correlates with more advanced stages

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
RNF182; PANDA_005987; E3 ubiquitin-protein ligase RNF182; RING finger protein 182; RING-type E3 ubiquitin transferase RNF182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Ailuropoda melanoleuca (Giant panda)
Target Names
RNF182
Target Protein Sequence
MASQSPDEAAEAQVSDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG VIVCPFCRFETCLPDEEVSSLPDDSNILVNLTCGGKGKKGLPENPTELLLTPKRLASLVS PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWKCTSLLFQT SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL DCVAPSS
Uniprot No.

Target Background

Function

RNF182 is an E3 ubiquitin-protein ligase that mediates the ubiquitination and subsequent proteasomal degradation of ATP6V0C. It also plays a role in inhibiting TLR-triggered innate immune responses by mediating Lys48-linked ubiquitination and degradation of the NF-κB component RELA.

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What tissue expression patterns are observed for RNF182?

RNF182 exhibits a tissue-specific expression pattern with the following characteristics:

  • Brain enrichment: RNF182 is predominantly expressed in neural tissues as a low abundance cytoplasmic protein .

  • Upregulation in pathological conditions: Expression levels are significantly elevated in:

    • Post-mortem Alzheimer's Disease brain tissue compared to age-matched controls

    • Neuronal cells subjected to oxygen and glucose deprivation (OGD)

    • Neurons exposed to combined β-amyloid peptide and OGD treatment

  • Downregulation in lung adenocarcinoma: Contrary to its upregulation in neurodegeneration, RNF182 shows decreased expression in lung adenocarcinoma (LUAD) tissues compared to non-involved lung tissues .

The differential expression of RNF182 across tissues and pathological conditions suggests context-dependent regulation and function. For research purposes, this expression pattern necessitates careful consideration of appropriate experimental models and tissue sources when studying this protein.

What are the known protein interactions and substrates of RNF182?

RNF182 has been identified to interact with several proteins that serve as its substrates for ubiquitination:

  • ATP6V0C:

    • Yeast two-hybrid screening, overexpression, and co-precipitation approaches have confirmed this interaction both in vitro and in vivo

    • RNF182 targets ATP6V0C for degradation via the ubiquitin-proteasome pathway

    • ATP6V0C is known for its role in the formation of gap junction complexes and neurotransmitter release channels

  • p65 (NF-κB subunit):

    • RNF182 modulates the ubiquitination and degradation of p65

    • This interaction specifically affects the protein level of p65 without altering its mRNA expression

    • RNF182 mediates K48-linked polyubiquitination of p65, marking it for proteasomal degradation

    • This interaction is physiologically significant as it results in suppression of TLR-induced NF-κB activation

  • Other potential substrates:

    • In in vitro ubiquitination assays, RNF182 exhibited substrate-independent, E2-dependent E3 ubiquitin ligase activity, suggesting it may target multiple proteins beyond those currently identified

These interactions position RNF182 as a regulator of both neuronal function (via ATP6V0C) and inflammatory responses (via p65), highlighting its versatile role in different cellular contexts.

How does RNF182 regulate inflammatory responses through the NF-κB pathway?

RNF182 functions as a negative regulator of Toll-like receptor (TLR) signaling by specifically targeting the p65 subunit of NF-κB. The regulatory mechanism involves:

  • Induction by TLR activation: RNF182 expression increases in a time-dependent manner following stimulation with LPS (a TLR4 ligand) and other TLR agonists, suggesting a feedback inhibition mechanism .

  • Specific suppression of NF-κB activation: Knockdown of RNF182 promotes:

    • Increased mRNA expression of IL-6 and TNF-α, but not IFN-β, upon challenge with LPS, poly(I:C), or CpG

    • Enhanced LPS or E.coli-induced NF-κB luciferase activity without affecting IFN-β luciferase activity

    • Elevated levels of phosphorylated p65 and total p65, without affecting other components of the pathway (IKKα/β, IκBα, IRF3, p50, p52, C-Rel, RelB)

  • Post-translational p65 regulation: RNF182 mediates K48-linked polyubiquitination of p65, leading to its proteasomal degradation . This occurs without affecting p65 mRNA expression, confirming that the regulation is exclusively post-translational .

This mechanism positions RNF182 as a potential therapeutic target for inflammatory conditions where excessive NF-κB activation contributes to pathology. Researchers studying inflammatory diseases may consider RNF182 modulators as a strategy to fine-tune inflammatory responses.

What is the relationship between RNF182 expression and cancer progression?

The relationship between RNF182 expression and cancer, particularly lung adenocarcinoma (LUAD), reveals a complex pattern:

  • Downregulation in LUAD: Analysis of the GSE136043 dataset identified RNF182 as a differentially expressed gene that is poorly expressed in LUAD compared to non-involved lung tissues .

  • Correlation with clinical features: RNF182 expression shows significant correlation with tumor progression parameters:

Clinical featuresSample size (n=47)RNF182 expressionp Value
High (n=22)Low (n=25)
T stage
T114113
T2-T4331122
N stage
N0301812
N1-N217413
M stage
M0412219
M1606
  • Mechanistic link to immune evasion: RNF182 has been found to regulate the p65/PDL1 axis in LUAD:

    • p65 is known to activate transcription of PDL1, a core immune checkpoint receptor

    • By modulating p65 levels, RNF182 may indirectly affect PDL1 expression and immune evasion

    • This suggests that low RNF182 expression in advanced LUAD may contribute to increased PDL1 expression and immune suppression

This data indicates that RNF182 may function as a tumor suppressor in LUAD, with its decreased expression correlating with advanced disease stages. The mechanism likely involves dysregulation of the p65/PDL1 axis, affecting both tumor cell proliferation and immune surveillance.

What experimental approaches are most effective for studying RNF182's E3 ligase activity?

To effectively study the E3 ligase activity of RNF182, researchers should consider the following methodological approaches:

  • In vitro ubiquitination assays:

    • Reaction components: ubiquitin, E1, E2, his-tagged or GST-tagged RNF182, and potential substrates

    • Controls should include reactions omitting E3 (RNF182), E1, E2, or ubiquitin

    • Detection via Western blotting, looking for high molecular weight smears indicative of polyubiquitination

    • Use of GST-SIAH-1 (another E3 ligase) as a positive control

  • Substrate identification approaches:

    • Yeast two-hybrid screening to identify potential interacting proteins

    • Co-immunoprecipitation experiments to confirm protein-protein interactions in vitro and in vivo

    • Mass spectrometry analysis of ubiquitinated proteins in cells with manipulated RNF182 expression

  • Functional validation of E3 ligase activity:

    • Overexpression systems to study the effects of wild-type vs. catalytically inactive RNF182 mutants

    • siRNA-mediated knockdown to assess the consequences of reduced RNF182 activity

    • Proteasome inhibitors (e.g., MG132) to confirm that the observed protein degradation is proteasome-dependent

    • Specific antibodies to distinguish between different ubiquitin chain types (K48-linked vs. K63-linked) to determine the type of ubiquitination mediated by RNF182

  • Cellular assays to assess biological consequences:

    • Cell viability assays, as RNF182 overexpression has been linked to reduced cell viability

    • Luciferase reporter assays to measure the activity of specific pathways (e.g., NF-κB) affected by RNF182

    • Gene expression analysis to assess downstream effects on target genes

When designing these experiments, researchers should be mindful of the low endogenous expression of RNF182 in most contexts, which may necessitate specialized detection methods or enrichment strategies.

How do the dual roles of RNF182 in neurodegeneration and cancer reconcile?

The seemingly paradoxical roles of RNF182 in neurodegeneration (upregulated) and cancer (downregulated) can be reconciled through several considerations:

  • Tissue-specific functions:

    • RNF182 is primarily a brain-enriched protein , suggesting its primary physiological role may be in neuronal homeostasis

    • Its function in other tissues might be context-dependent and regulated by tissue-specific factors

  • Substrate availability:

    • Different substrates may be available in neural versus epithelial tissues

    • While RNF182 targets ATP6V0C in neuronal contexts , its interaction with p65 appears more relevant in immune and cancer contexts

  • Cell death regulation:

    • In neuronal cells, RNF182 upregulation correlates with increased cell death

    • In cancer cells, where resistance to apoptosis is a hallmark, downregulation of RNF182 may promote cell survival and progression

  • Inflammatory pathway modulation:

    • RNF182 suppresses NF-κB activation by targeting p65 for degradation

    • In neurodegeneration, this may contribute to dysregulated inflammatory responses in the brain

    • In cancer, reduced RNF182 would lead to increased NF-κB activity, promoting tumor progression and immune evasion through PDL1 upregulation

The understanding of these dual roles is essential for therapeutic targeting of RNF182. Potential interventions would need to be highly context-specific to avoid unintended consequences across different tissues.

What challenges arise in studying low-abundance proteins like RNF182?

Studying low-abundance proteins like RNF182 presents several technical challenges that researchers should address:

  • Detection limitations:

    • Standard Western blotting may not be sensitive enough for endogenous RNF182 detection

    • Specialized approaches such as enhanced chemiluminescence, fluorescent secondary antibodies, or amplification steps may be necessary

    • Consider using targeted mass spectrometry approaches like selected reaction monitoring (SRM) for enhanced sensitivity

  • Expression systems:

    • Recombinant expression is often necessary for functional studies

    • Optimize expression conditions to ensure proper folding and activity of the RING finger domain, which requires appropriate zinc coordination

    • Consider using fusion tags (His, GST) that facilitate purification while maintaining protein function

  • Storage and stability considerations:

    • Store at -20°C for short-term or -80°C for extended storage

    • Use stabilizing buffers containing glycerol (e.g., 50% glycerol in Tris-based buffer)

    • Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week

  • Validation of antibody specificity:

    • Perform careful controls including knockdown/knockout samples to confirm antibody specificity

    • Consider epitope mapping to ensure antibodies recognize functionally relevant domains

    • Use multiple antibodies targeting different epitopes for confirmation of results

  • Transient nature of ubiquitination interactions:

    • E3 ligase interactions with substrates are often transient and may require crosslinking approaches for capture

    • Proteasome inhibitors should be used to prevent degradation of ubiquitinated targets

    • Denaturing conditions during immunoprecipitation may be necessary to disrupt associated proteins

These methodological considerations are essential for generating reliable and reproducible data when studying RNF182 and similar low-abundance E3 ubiquitin ligases.

How can RNF182 expression be effectively modulated in experimental systems?

To effectively modulate RNF182 expression for experimental purposes, researchers can employ several approaches:

  • RNA interference (RNAi):

    • siRNA transfection has been successfully used to silence Rnf182 expression in primary macrophages

    • Validation of knockdown efficiency should be performed at both mRNA and protein levels

    • Consider using multiple siRNA sequences to control for off-target effects

  • Overexpression systems:

    • Plasmid-based expression of RNF182 has been employed to study its effects on cell viability

    • Co-transfection approaches can be used to rescue phenotypes observed in knockdown experiments

    • Both constitutive and inducible expression systems may be valuable, especially given RNF182's potential cytotoxicity when overexpressed

  • CRISPR-Cas9 genome editing:

    • For long-term studies, consider generating stable knockout or knockin cell lines

    • Inducible CRISPR systems may help overcome issues related to cellular adaptation to constitutive RNF182 depletion

    • Include appropriate controls and validation of off-target effects

  • Pharmacological modulation:

    • Since direct modulators of RNF182 are not currently reported, consider targeting upstream regulators

    • TLR agonists like LPS have been shown to increase RNF182 expression in a time-dependent manner

    • Neuronal stress inducers like oxygen-glucose deprivation (OGD) also upregulate RNF182

When designing these experiments, researchers should carefully consider:

  • Cell type selection (neuronal versus non-neuronal)

  • Potential toxicity of high RNF182 expression

  • Appropriate timing for analyses based on the degradation rate of RNF182 substrates

  • Inclusion of proper controls for the specific modulation approach

What cellular models are most appropriate for studying RNF182 function?

The choice of cellular models for studying RNF182 should be guided by its known expression patterns and the specific aspects of its function being investigated:

  • Neuronal models:

    • Post-mitotic NT2 neurons have been used to study RNF182 upregulation in response to oxygen and glucose deprivation (OGD)

    • N2a neuroblastoma cells have been utilized to assess the effects of RNF182 overexpression on cell viability

    • Primary neuronal cultures may provide a more physiologically relevant system for studying RNF182's role in neurodegeneration

  • Immune cell models:

    • Primary macrophages have been effectively used to study RNF182's role in TLR signaling

    • These models are particularly suitable for investigating inflammatory pathway regulation

    • Consider monocyte/macrophage cell lines like THP-1 or RAW264.7 for initial screening studies

  • Cancer cell models:

    • A549 and NCI-H1975 lung adenocarcinoma cell lines have been employed to study RNF182's role in cancer progression

    • These models are appropriate for investigating the p65/PDL1 axis regulation

    • Consider paired normal-tumor cell lines to study differential regulation of RNF182

  • Co-culture systems:

    • LUAD cells co-cultured with CD8+ T cells have been used to study immune interactions affected by RNF182

    • Neuron-glia co-cultures may be valuable for studying RNF182's role in neuroinflammatory processes

    • These systems can provide insights into cell-cell interactions influenced by RNF182

  • In vivo models:

    • Consider transgenic mouse models with conditional RNF182 knockout or overexpression

    • Brain-specific or immune-specific Cre drivers would allow tissue-specific modulation

    • Validate findings from cellular models in the appropriate in vivo context

When selecting a model system, researchers should consider the endogenous expression level of RNF182, the presence of relevant substrates, and the specific signaling pathways being investigated.

How can researchers effectively study the dual role of RNF182 in cell death and inflammation?

Studying the dual functionality of RNF182 in cell death and inflammation requires integrated experimental approaches:

  • Combined pathway analysis:

    • Simultaneously assess cell death markers (e.g., cleaved caspase-3, PARP cleavage) and inflammatory signaling (e.g., NF-κB activation, cytokine production)

    • Use time-course experiments to determine the temporal relationship between RNF182 upregulation, inflammatory responses, and cell death

    • Employ pathway inhibitors to dissect causal relationships

  • Substrate-specific approaches:

    • Generate substrate-binding mutants of RNF182 that selectively affect interaction with either ATP6V0C or p65

    • Compare the effects of wild-type vs. mutant RNF182 on cell death and inflammatory outcomes

    • Use substrate-specific siRNAs to determine whether the effects of RNF182 are mediated through specific targets

  • Stress-specific regulation:

    • Compare RNF182 regulation and function across different stressors:

      • Neurodegenerative stimuli (β-amyloid, oxygen-glucose deprivation)

      • Inflammatory triggers (LPS, poly(I:C), CpG, E.coli)

      • Cancer-related stresses (hypoxia, nutrient deprivation)

    • Determine whether different stressors induce functionally distinct forms of RNF182

  • Multi-omics approaches:

    • Combine transcriptomics, proteomics, and ubiquitinomics to comprehensively map RNF182-dependent changes

    • Identify novel substrates and pathways affected by RNF182 modulation

    • Use systems biology approaches to integrate these datasets and identify regulatory nodes

  • Domain-function analysis:

    • Create domain deletion mutants to identify regions responsible for specific functions

    • Focus on the RING finger domain for E3 ligase activity and other domains for substrate recognition

    • Use structure-function approaches to design specific inhibitors of RNF182-substrate interactions

These integrated approaches will help elucidate how RNF182 coordinates its seemingly opposing functions in different cellular contexts and in response to various stressors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.